SitesBLAST
Comparing Echvi_1497 FitnessBrowser__Cola:Echvi_1497 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8bb8A Crystal structure of human aldehyde dehydrogenase aldh3a1 in complex with octanal (see paper)
40% identity, 96% coverage: 2:450/469 of query aligns to 3:444/447 of 8bb8A
P30838 Aldehyde dehydrogenase, dimeric NADP-preferring; ALDHIII; Aldehyde dehydrogenase 3; Aldehyde dehydrogenase family 3 member A1; EC 1.2.1.5 from Homo sapiens (Human) (see 4 papers)
40% identity, 96% coverage: 2:450/469 of query aligns to 4:445/453 of P30838
- S134 (= S132) to A: in dbSNP:rs887241
- E210 (= E208) active site
- C244 (= C242) active site; mutation to S: Abolishes activity.
- P329 (≠ D335) to A: in allele ALDH3A1*2; dbSNP:rs2228100
3szbA Crystal structure of human aldh3a1 modified with the beta-elimination product of aldi-1; 1-phenyl- 2-propen-1-one (see paper)
40% identity, 96% coverage: 2:450/469 of query aligns to 3:444/447 of 3szbA
4l1oB Crystal structure of human aldh3a1 with inhibitor 1-{[4-(1,3- benzodioxol-5-ylmethyl)piperazin-1-yl]methyl}-1h-indole-2,3-dione
40% identity, 96% coverage: 2:450/469 of query aligns to 3:444/452 of 4l1oB
- active site: N114 (= N113), K137 (= K136), E209 (= E208), C243 (= C242), E333 (= E340), Y412 (≠ S419)
- binding (3S)-1-{[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]methyl}-3-hydroxy-1,3-dihydro-2H-indol-2-one: Y115 (= Y114), N118 (= N117), L119 (= L118), E209 (= E208), T242 (= T241), C243 (= C242), I391 (≠ A398), I394 (≠ F401), F401 (= F408), H413 (= H420)
4l2oA Crystal structure of human aldh3a1 with its selective inhibitor 1-(4- fluorophenyl)sulfonyl-2-methylbenzimidazole
40% identity, 96% coverage: 2:450/469 of query aligns to 3:444/446 of 4l2oA
- active site: N114 (= N113), K137 (= K136), E209 (= E208), C243 (= C242), E333 (= E340), Y412 (≠ S419)
- binding 1-[(4-fluorophenyl)sulfonyl]-2-methyl-1H-benzimidazole: E61 (≠ T60), Y65 (≠ F64), Y115 (= Y114), N118 (= N117), L119 (= L118), M237 (≠ I236), C243 (= C242), I391 (≠ A398), I394 (≠ F401), T395 (≠ L402), F401 (= F408), H413 (= H420)
- binding nicotinamide-adenine-dinucleotide: T112 (≠ P111), W113 (= W112), N114 (= N113), L119 (= L118), E140 (= E139), V169 (= V168), T186 (= T185), G187 (= G186), S188 (= S187), V191 (= V190), E209 (= E208), L210 (= L209), G211 (= G210), C243 (= C242), H289 (= H291), E333 (= E340), F335 (= F342), F401 (= F408)
4h80A Crystal structure of human aldh3a1 with its isozyme selective inhibitor - n-[4-(4-methylsulfonyl-2-nitroanilino)phenyl]acetamide
40% identity, 96% coverage: 2:450/469 of query aligns to 3:444/446 of 4h80A
- active site: N114 (= N113), K137 (= K136), E209 (= E208), C243 (= C242), E333 (= E340), Y412 (≠ S419)
- binding N-(4-{[4-(methylsulfonyl)-2-nitrophenyl]amino}phenyl)acetamide: E61 (≠ T60), Y65 (≠ F64), Y115 (= Y114), N118 (= N117), W233 (≠ I232), T242 (= T241), C243 (= C242), V244 (≠ I243), I394 (≠ F401), T395 (≠ L402), F401 (= F408)
P51648 Aldehyde dehydrogenase family 3 member A2; Aldehyde dehydrogenase 10; Fatty aldehyde dehydrogenase; Microsomal aldehyde dehydrogenase; EC 1.2.1.3; EC 1.2.1.94 from Homo sapiens (Human) (see 5 papers)
41% identity, 95% coverage: 6:450/469 of query aligns to 5:442/485 of P51648
- I45 (≠ L46) to F: in SLS; severe loss of activity
- V64 (= V65) to D: in SLS; severe loss of activity; dbSNP:rs72547556
- L106 (= L107) to R: in SLS; severe loss of activity; dbSNP:rs72547558
- N112 (= N113) mutation to A: Loss of enzyme activity.
- P114 (= P115) to L: in SLS; severe loss of activity; dbSNP:rs72547559
- P121 (= P122) to L: in SLS; severe loss of activity; dbSNP:rs72547560
- T184 (= T185) to M: in SLS; severe loss of activity; dbSNP:rs72547562; to R: in SLS; severe loss of activity
- G185 (= G186) to A: in SLS; severe loss of activity; dbSNP:rs72547563
- E207 (= E208) active site; mutation to Q: Loss of enzyme activity.
- C214 (≠ A215) to Y: in SLS; 4% of activity; dbSNP:rs72547564
- R228 (≠ K229) to C: in SLS; severe loss of activity; dbSNP:rs72547566
- C237 (≠ S238) to Y: in SLS; severe loss of activity; dbSNP:rs72547567
- C241 (= C242) active site; mutation to S: Loss of enzyme activity.
- D245 (= D246) to N: in SLS; severe loss of activity; dbSNP:rs72547568
- K266 (≠ N267) to N: in SLS; mild reduction of activity; the underlying nucleotide substitution affects transcript stability; dbSNP:rs72547569
- Y279 (= Y283) to N: in SLS; severe loss of activity; dbSNP:rs72547570
- AP 314:315 (≠ EP 323:324) natural variant: AP -> GAKSTVGA (in SLS; 8% of activity)
- P315 (= P324) to S: in SLS; common mutation in Europeans; severe loss of enzymatic activity; dbSNP:rs72547571
- E331 (= E340) mutation to Q: Loss of enzyme activity.
- S365 (≠ T374) to L: in SLS; severe loss of activity; dbSNP:rs72547573
- Y410 (≠ S419) mutation to F: Decreased enzyme activity with dodecanal and hexadecanal. No effect on enzyme activity with octanal.
- H411 (= H420) to Y: in SLS; severe loss of activity
- S415 (≠ G424) to N: in SLS; severe loss of activity
- F419 (= F428) to S: in SLS; severe loss of activity; dbSNP:rs72547576
- R423 (≠ K432) to H: in SLS; severe loss of activity; dbSNP:rs768290318
Sites not aligning to the query:
- 445:485 mutation Missing: Decreased enzyme activity with dodecanal. Strongly decreased enzyme activity with hexadecanal. No effect on enzyme activity with octanal.
- 447 K → E: in SLS; severe loss of activity; dbSNP:rs67939114
1ad3A Class 3 aldehyde dehydrogenase complex with nicotinamide-adenine- dinucleotide (see paper)
40% identity, 96% coverage: 2:450/469 of query aligns to 2:443/446 of 1ad3A
- active site: N113 (= N113), K136 (= K136), E208 (= E208), C242 (= C242), E332 (= E340), Y411 (≠ S419)
- binding nicotinamide-adenine-dinucleotide: A111 (≠ P111), W112 (= W112), N113 (= N113), E139 (= E139), V140 (≠ H140), V168 (= V168), G186 (= G186), V190 (= V190), H288 (= H291), R291 (= R294), E332 (= E340), F334 (= F342)
Q80VQ0 Aldehyde dehydrogenase family 3 member B1; Aldehyde dehydrogenase 7; EC 1.2.1.28; EC 1.2.1.5; EC 1.2.1.7 from Mus musculus (Mouse) (see paper)
40% identity, 94% coverage: 24:464/469 of query aligns to 26:459/468 of Q80VQ0
Sites not aligning to the query:
- 462 modified: S-palmitoyl cysteine; C→S: Reduces palmitoylation.
- 462:463 CC→SS: Abolishes palmitoylation.
- 463 modified: S-palmitoyl cysteine; C→S: Reduces palmitoylation.
J3QMK6 Aldehyde dehydrogenase family 3 member B3; EC 1.2.1.3 from Mus musculus (Mouse) (see paper)
39% identity, 98% coverage: 2:460/469 of query aligns to 17:468/479 of J3QMK6
- RR 462:463 (≠ KT 454:455) mutation to AA: Reduces membrane localization.
Q70DU8 Aldehyde dehydrogenase family 3 member H1; AtALDH4; Ath-ALDH4; EC 1.2.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
39% identity, 94% coverage: 24:463/469 of query aligns to 34:469/484 of Q70DU8
- C45 (≠ I35) mutation to S: Decreased solubility, loss of dimerization and strongly decreased activity.
- E149 (= E139) mutation to D: Small effect on NAD(+) interaction, but 40% loss of efficiency. Ability to use NADP(+). 70% loss of efficiency with NAD(+); when associated with V-200. Impaired affinity for both cofactors and decreased catalytic efficiency; when associated with G-200.; mutation to N: Ability to use NADP(+) and 33% decreased efficiency with NAD(+). 70% loss of efficiency with NAD(+); when associated with V-200. Impaired affinity for both cofactors and decreased catalytic efficiency; when associated with G-200.; mutation to Q: Loss of specificity for NAD(+) and loss of 25% efficiency. 15% efficiency with NAD(+); when associated with V-200. Impaired affinity for both cofactors and decreased catalytic efficiency; when associated with G-200.; mutation to T: Loss of specificity and increased NADP(+) binding. Decreased catalytic efficiency. Loss of cofactor specificity and same lower efficiency with both; when associated with V-200. Impaired affinity for both cofactors and decreased catalytic efficiency; when associated with G-200. Changed coenzyme preference from NAD(+) to NADP(+), but no effect on the catalytic efficiency; when associated with R-178 and V-200.
- V178 (= V168) mutation to R: Changed coenzyme preference from NAD(+) to NADP(+), but no effect on the catalytic efficiency; when associated with T-149 and V-200.
- I200 (≠ V190) mutation to G: Changed coenzyme preference from NAD(+) to NADP(+), but impaired affinities for both cofactors. No effect on the interaction with the substrate. Impaired affinities for both cofactors and decreased catalytic efficiencies; when associated with D-149, Q-149, N-149 or T-149.; mutation to V: Also able to use NADP(+) as coenzyme, but no effect on the interaction with the substrate. 15% efficiency with NAD(+); when associated with Q-149. 70% loss of efficiency with NAD(+); when associated with D-149 or N-149. Loss of cofactor specificity and same lower efficiency with both; when associated with T-149. Changed coenzyme preference from NAD(+) to NADP(+), but no effect on the catalytic efficiency; when associated with T-149 and R-178.
- C247 (≠ I236) mutation to S: No effect on solubility, but 10% loss of activity.
- C253 (= C242) mutation to S: No effect on solubility, but loss of activity.
E9Q3E1 Aldehyde dehydrogenase family 3 member B2; Aldehyde dehydrogenase 8; EC 1.2.1.3 from Mus musculus (Mouse) (see paper)
40% identity, 91% coverage: 24:452/469 of query aligns to 39:460/479 of E9Q3E1
Sites not aligning to the query:
- 462 W→A: Reduces lipid droplet localization.
- 469 W→A: Reduces lipid droplet localization.
- 476 C→S: Reduces lipid droplet localization.
Q8W033 Aldehyde dehydrogenase family 3 member I1, chloroplastic; AtALDH3; Ath-ALDH3; EC 1.2.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
40% identity, 94% coverage: 24:463/469 of query aligns to 97:532/550 of Q8W033
- C114 (≠ E41) mutation to S: No effect on solubility, but loss of dimerization and 80% loss of activity.
- C142 (≠ I69) mutation to S: No effect on solubility, but decreased activity.
- V263 (= V190) mutation to I: No effect on substrate specificity, but decreased affinity for NADP(+) and increased affinity for NAD(+).
- C286 (≠ S213) mutation to S: No effect on solubility, but no effect on activity.
- C310 (≠ I236) mutation to S: No effect on solubility, but no effect on activity.
- C316 (= C242) mutation to S: No effect on solubility, but loss of activity.
P43353 Aldehyde dehydrogenase family 3 member B1; Aldehyde dehydrogenase 7; EC 1.2.1.28; EC 1.2.1.5; EC 1.2.1.7 from Homo sapiens (Human) (see paper)
39% identity, 91% coverage: 24:450/469 of query aligns to 26:445/468 of P43353
Sites not aligning to the query:
- 463 modified: S-palmitoyl cysteine
- 465 modified: S-geranylgeranyl cysteine
5ucdA Benzaldehyde dehydrogenase, a class 3 aldehyde dehydrogenase, with bound NADP+ and benzoate adduct (see paper)
40% identity, 92% coverage: 2:434/469 of query aligns to 8:431/435 of 5ucdA
- active site: N119 (= N113), K142 (= K136), E214 (= E208), C248 (= C242), E336 (= E340), Y416 (≠ S419)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I115 (= I109), G116 (≠ S110), F118 (≠ W112), N119 (= N113), K142 (= K136), S144 (= S138), E145 (= E139), R174 (≠ V168), F190 (= F184), T191 (= T185), G192 (= G186), S193 (= S187), V196 (= V190), E214 (= E208), L215 (= L209), C248 (= C242), E336 (= E340), F338 (= F342)
5nnoA Structure of tbaldh3 complexed with NAD and an3057 aldehyde (see paper)
36% identity, 94% coverage: 21:463/469 of query aligns to 31:484/484 of 5nnoA
- active site: N123 (= N113), K146 (= K136), E218 (= E208), S254 (≠ C242), E360 (= E340), Y439 (≠ S419)
- binding 4-[(1-oxidanyl-3~{H}-2,1-benzoxaborol-5-yl)oxy]benzaldehyde: P74 (≠ F64), Y124 (= Y114), L127 (≠ N117), T253 (= T241), S254 (≠ C242), G422 (≠ L402)
- binding nicotinamide-adenine-dinucleotide: I119 (= I109), G120 (≠ S110), W122 (= W112), N123 (= N113), L128 (= L118), K146 (= K136), E149 (= E139), V178 (= V168), T181 (= T171), Y194 (≠ F184), T195 (= T185), G196 (= G186), S197 (= S187), V200 (= V190), E218 (= E208), L219 (= L209), S254 (≠ C242), E360 (= E340), F362 (= F342), F428 (= F408)
Q04458 Fatty aldehyde dehydrogenase HFD1; Hexadecenal dehydrogenase; EC 1.2.1.3; EC 1.2.1.64 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
34% identity, 96% coverage: 17:464/469 of query aligns to 42:495/532 of Q04458
- S241 (= S213) mutation to L: Causes Q deficiency.
- C273 (= C242) mutation to S: Abolishes catalytic activity.
O14293 Putative aldehyde dehydrogenase-like protein C9E9.09c; EC 1.2.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
34% identity, 72% coverage: 96:434/469 of query aligns to 154:493/503 of O14293
- S248 (= S187) modified: Phosphoserine
Sites not aligning to the query:
- 501 modified: Phosphoserine
8c54A Cryo-em structure of nadh bound sla dehydrogenase rlgabd from rhizobium leguminosarum bv. Trifolii srd1565
31% identity, 87% coverage: 17:426/469 of query aligns to 64:472/482 of 8c54A
- binding 1,4-dihydronicotinamide adenine dinucleotide: I152 (= I109), T153 (≠ S110), P154 (= P111), K179 (= K136), A212 (≠ G167), K213 (≠ V168), F230 (= F184), T231 (= T185), G232 (= G186), S233 (= S187), V236 (= V190), W239 (≠ I193), G256 (= G210)
P17202 Aminoaldehyde dehydrogenase BADH; 4-trimethylammoniobutyraldehyde dehydrogenase BADH; Aminobutyraldehyde dehydrogenase BADH; Betaine aldehyde dehydrogenase; SoBADH; EC 1.2.1.-; EC 1.2.1.47; EC 1.2.1.19; EC 1.2.1.8 from Spinacia oleracea (Spinach) (see 3 papers)
32% identity, 72% coverage: 95:434/469 of query aligns to 141:482/497 of P17202
- SPW 156:158 (= SPW 110:112) binding
- Y160 (= Y114) mutation to A: Decreases binding affinity for betaine aldehyde; increases binding affinity for 4-(trimethylamino)butanal.
- W167 (≠ A121) mutation to A: Decreases binding affinity for betaine aldehyde; increases binding affinity for 4-aminobutanal.
- KPSE 182:185 (= KPSE 136:139) binding
- L186 (≠ H140) binding
- SSAT 236:239 (≠ STEV 187:190) binding
- V251 (≠ L202) binding in other chain
- L258 (= L209) binding
- W285 (≠ I236) mutation to A: Decreases binding affinity for betaine aldehyde.
- E390 (= E340) binding
- A441 (= A391) mutation to I: Decreases binding affinity for betaine aldehyde; increases binding affinity for 4-aminobutanal.
- C450 (≠ Q400) mutation to S: Loss of partial inactivation by betaine aldehyde in the absence of NAD(+).
- W456 (≠ F408) binding ; mutation to A: Decreases binding affinity for betaine aldehyde.
- K460 (≠ G412) binding
Sites not aligning to the query:
Query Sequence
>Echvi_1497 FitnessBrowser__Cola:Echvi_1497
MIQETVQAQKQKALKNQQSTLSSRIKKLEQLKEWIKSNQKEIEKALYADLRKPAAEVAVT
ETSFVVMEINAALKQLPKWTAPTKVGQPIHMLGTQAYLQAEPKGAVLIISPWNYPFNLSV
APLVSAIAAGCSACLKPSEHSPHTSALLRRMVTELFAVEDVTIFEGGVPVTSELLEQPFD
HIFFTGSTEVGKIVMKAAAKNLTSVTLELGGKSPAIIDQGFDLEDAAKKIAIGKFINSGQ
TCIAPDYLFVHESQKQDFIETLKAQVNRMYNANGKGFDRNPDYGRIIHAPHIVRLQNMLK
DAQTKGAHVEFGGKNSLDQQFMEPTVVSNVSEAMDLMKEEIFGPILPIITYHQLDDVIQL
IQLKPKPLAVYAFTTDDRIIEQLSKNTSSGALVINDCAIQFLHSELPFGGIGASGMGRSH
GHAGFLAFSNEKAILKQRTGKTLPKLLYPPYGLKTSGIIKAFMKWVMKG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory