SitesBLAST
Comparing Echvi_1519 FitnessBrowser__Cola:Echvi_1519 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
45% identity, 97% coverage: 4:432/444 of query aligns to 9:424/425 of O59010
- S65 (= S61) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S289) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SSS 289:291) binding
- M311 (= M325) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (= T328) binding
- V355 (= V369) binding
- D394 (= D402) binding
- M395 (= M403) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R405) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N409) binding
- D405 (= D413) mutation to N: Strongly decreased affinity for aspartate.
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
44% identity, 95% coverage: 4:425/444 of query aligns to 1:409/409 of 6bavA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
44% identity, 95% coverage: 4:427/444 of query aligns to 9:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ I42), F46 (≠ I42), P75 (≠ D71), L91 (≠ M88), F95 (≠ I92), L130 (vs. gap), I133 (≠ P144), I159 (= I171), Y167 (vs. gap), K196 (= K201), G200 (≠ Y205), I207 (≠ Y212), F210 (= F215), L250 (≠ I262), I262 (≠ F275), M269 (≠ Q282), T334 (≠ S348), V335 (≠ L349), G336 (≠ T350), T340 (≠ M354), L343 (= L357), M399 (≠ V407)
- binding aspartic acid: S277 (= S290), S278 (= S291), T314 (= T328), G354 (= G368), A358 (= A372), G359 (= G373), D394 (= D402), R397 (= R405), T398 (= T406)
- binding sodium ion: Y89 (= Y86), T92 (= T89), S93 (≠ T90), G306 (= G320), T308 (= T322), N310 (= N324), N310 (= N324), M311 (= M325), D312 (= D326), S349 (= S363), I350 (= I364), T352 (= T366), N401 (= N409), V402 (= V410), D405 (= D413)
Sites not aligning to the query:
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
44% identity, 95% coverage: 4:424/444 of query aligns to 1:408/408 of 6bauA
- binding cysteine: S270 (= S291), M303 (= M325), T306 (= T328), A345 (= A367), G346 (= G368), V347 (= V369), G351 (= G373), D386 (= D402), C389 (≠ R405), T390 (= T406), N393 (= N409)
2nwwA Crystal structure of gltph in complex with tboa (see paper)
44% identity, 94% coverage: 6:424/444 of query aligns to 2:407/407 of 2nwwA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
43% identity, 95% coverage: 4:424/444 of query aligns to 6:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G65), V83 (≠ I83), I157 (= I172), Y164 (vs. gap), K193 (= K201), T305 (= T322), I306 (= I323), I347 (= I364)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (= I11), M199 (= M207), S275 (= S291), T311 (= T328), G356 (= G373), L384 (= L395), D391 (= D402), R394 (= R405)
Sites not aligning to the query:
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
43% identity, 95% coverage: 6:429/444 of query aligns to 9:421/426 of 6xwnB
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
43% identity, 95% coverage: 6:429/444 of query aligns to 7:419/425 of 6zgbA
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
43% identity, 95% coverage: 6:429/444 of query aligns to 9:421/427 of 5e9sA
- binding aspartic acid: R274 (≠ S289), S275 (= S290), S276 (= S291), T313 (= T328), G353 (= G368), V354 (= V369), A357 (= A372), G358 (= G373), D394 (= D402), R397 (= R405), T398 (= T406)
- binding decyl-beta-d-maltopyranoside: L194 (≠ K201), G198 (≠ Y205), Y202 (≠ I209)
- binding sodium ion: Y87 (= Y86), T90 (= T89), S91 (≠ T90), S276 (= S291), G305 (= G320), A306 (= A321), T307 (= T322), N309 (= N324), N309 (= N324), M310 (= M325), D311 (= D326), S348 (= S363), I349 (= I364), G350 (= G365), T351 (= T366), N401 (= N409), V402 (= V410), D405 (= D413)
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
43% identity, 95% coverage: 6:429/444 of query aligns to 6:418/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ K201), G195 (≠ Y205), R282 (≠ K300)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S289), S272 (= S290), S273 (= S291), M307 (= M325), T310 (= T328), G353 (= G371), A354 (= A372), R394 (= R405), T395 (= T406)
Sites not aligning to the query:
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
43% identity, 95% coverage: 6:429/444 of query aligns to 2:410/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S289), S265 (= S291), M299 (= M325), T302 (= T328), T340 (= T366), G342 (= G368), V343 (= V369), G347 (= G373), D383 (= D402), R386 (= R405), T387 (= T406), N390 (= N409)
- binding decyl-beta-d-maltopyranoside: H23 (≠ K27), V212 (≠ L237), A216 (≠ L241)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
42% identity, 95% coverage: 4:424/444 of query aligns to 1:396/396 of 6bmiA
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
37% identity, 90% coverage: 15:414/444 of query aligns to 29:450/503 of Q10901
- N177 (≠ P150) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N187 (= N160) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
37% identity, 89% coverage: 18:414/444 of query aligns to 33:392/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ L75), G89 (= G76), G92 (= G79), A95 (≠ T82), V96 (≠ I83), Y99 (= Y86), M163 (≠ I171), F167 (≠ I175), F293 (= F315), V297 (≠ L319)
- binding aspartic acid: S268 (= S290), S269 (= S291), T306 (= T328), G346 (= G368), I347 (≠ V369), A350 (= A372), G351 (= G373), D380 (= D402), R383 (= R405), T384 (= T406)
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
36% identity, 93% coverage: 2:414/444 of query aligns to 5:405/425 of 7xr4A
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
35% identity, 93% coverage: 2:414/444 of query aligns to 6:404/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S290), S281 (= S291), T318 (= T328), G363 (= G373), M367 (≠ L377), V385 (≠ L395), D388 (= D398), R395 (= R405), T396 (= T406)
- binding dodecyl beta-D-glucopyranoside: V16 (≠ I12), V19 (≠ L15), I20 (≠ V16), W389 (≠ R399)
- binding cholesterol hemisuccinate: R80 (= R77), R84 (≠ K81), I95 (= I92), I252 (= I262)
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
33% identity, 91% coverage: 12:414/444 of query aligns to 51:486/572 of P43006
Sites not aligning to the query:
- 38 modified: S-palmitoyl cysteine; C→S: Severely impairs glutamate uptake activity.
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
37% identity, 89% coverage: 18:414/444 of query aligns to 25:378/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ V66), S80 (≠ L75), G81 (= G76), G84 (= G79), Y91 (= Y86), M156 (≠ I171), F160 (≠ I175), F286 (= F315), V290 (≠ L319)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V58), I148 (≠ M163), S262 (= S291), S263 (= S292), A292 (= A321), T293 (= T322), M296 (= M325), T299 (= T328), G329 (= G365), A336 (= A372), G337 (= G373), D366 (= D402), R369 (= R405), N373 (= N409)
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
35% identity, 92% coverage: 7:414/444 of query aligns to 3:389/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (= S61), L58 (= L62), L65 (= L69), V339 (≠ I364), G340 (= G365), S343 (≠ G368), I344 (≠ V369)
- binding cholesterol: W188 (≠ L208), I227 (≠ L253), F250 (= F275), W257 (≠ Q282), M379 (≠ F404), S382 (≠ V407)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S291), M300 (= M325), T303 (= T328), Y306 (= Y331), G348 (= G373), L349 (= L374), M352 (≠ L377), I366 (≠ L391), L369 (≠ I394), V370 (≠ L395), D373 (= D398), D377 (= D402), R380 (= R405), T381 (= T406), N384 (= N409)
Sites not aligning to the query:
P31596 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; GLUT-R; Solute carrier family 1 member 2 from Rattus norvegicus (Rat) (see paper)
33% identity, 91% coverage: 12:414/444 of query aligns to 51:486/573 of P31596
- K298 (≠ L221) mutation K->H,R: Normal transporter activity.; mutation K->N,T: Reduced transporter activity.
- H326 (≠ M254) mutation H->N,T,K,R: No transporter activity.
Query Sequence
>Echvi_1519 FitnessBrowser__Cola:Echvi_1519
MLKKIPLHTQIIIGLVLGLVFGLIVIKTQMSPDFTMDYIKPIGTIFINGLKMIAVPLVLA
SLIVGVSNLGDITKLGRIGGKTIGAYMMTTVIAVTVGLLLVNVFAPGKSLPIETRERLME
QFDDVVGDKSSQAAELKEQTPLKPLVDMVPENVFLAAADNGSMLQVVFFAIIVGIALLEI
PKSKASPVIAFFDGLNDVIIKIVGYIMLIAPYGVFALMASLIVEIAGDNPDSAIELLFAL
LKYSLLVVAGLLLMIVLVYPTILKLFTKVKYKDFFAALRPAQLLAFSTSSSSATLPVTMK
QVEEEIGVSEEVSSFVLPLGATINMDGTCLYQGVAAVFIAQALGLDLSLTQQLMIVLTAT
LASIGTAGVPGAGLIMLLIVLESIGVPSAGLALILAPDRILDMFRTVVNVTGDATVCTVV
ASTEGELPDGLIRESNPLTTTSDA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory