SitesBLAST
Comparing Echvi_1524 FitnessBrowser__Cola:Echvi_1524 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2j6hA E. Coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo- l-norleucine (see paper)
44% identity, 100% coverage: 2:613/613 of query aligns to 1:608/608 of 2j6hA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W75), N98 (= N101), G99 (= G102), Y248 (= Y252), E481 (= E486), K485 (= K490), E488 (= E493), H504 (= H509), K603 (= K608)
- binding glucose-6-phosphate: T302 (= T307), S347 (= S352), Q348 (= Q353), S349 (= S354), T352 (= T357), V399 (= V403), S401 (= S405), E488 (= E493)
- binding 5-oxo-l-norleucine: C1 (= C2), R73 (= R74), W74 (= W75), T76 (= T77), H86 (= H87), N98 (= N101), G99 (= G102), D123 (= D126)
4amvA E.Coli glucosamine-6p synthase in complex with fructose-6p (see paper)
44% identity, 100% coverage: 2:613/613 of query aligns to 1:608/608 of 4amvA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W75), N98 (= N101), G99 (= G102), Y248 (= Y252), E481 (= E486), K485 (= K490), E488 (= E493), H504 (= H509), K603 (= K608)
- binding fructose -6-phosphate: G301 (= G306), T302 (= T307), S303 (= S308), S347 (= S352), Q348 (= Q353), S349 (= S354), T352 (= T357), S401 (= S405), K485 (= K490), E488 (= E493)
1jxaA Glucosamine 6-phosphate synthase with glucose 6-phosphate (see paper)
44% identity, 100% coverage: 2:613/613 of query aligns to 1:608/608 of 1jxaA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W75), N98 (= N101), G99 (= G102), Y248 (= Y252), E481 (= E486), K485 (= K490), E488 (= E493), H504 (= H509), K603 (= K608)
- binding glucose-6-phosphate: T302 (= T307), S303 (= S308), S347 (= S352), Q348 (= Q353), S349 (= S354), T352 (= T357), S401 (= S405), K485 (= K490), E488 (= E493)
6svmA Crystal structure of human gfat-1 in complex with glucose-6-phosphate, l-glu, and udp-galnac (see paper)
40% identity, 100% coverage: 2:613/613 of query aligns to 1:660/660 of 6svmA
- active site: L7 (≠ V8), R32 (= R27), W95 (= W75), N122 (= N101), G123 (= G102), E533 (= E486), K537 (= K490), E540 (= E493), H556 (= H509), K655 (= K608)
- binding glucose-6-phosphate: C353 (= C305), T355 (= T307), S356 (= S308), S400 (= S352), Q401 (= Q353), S402 (= S354), T405 (= T357), S453 (= S405), K537 (= K490), E540 (= E493)
- binding glutamic acid: C1 (= C2), R94 (= R74), W95 (= W75), T97 (= T77), H107 (= H87), G123 (= G102), D147 (= D126)
- binding magnesium ion: S434 (≠ A386), R435 (= R387), T437 (= T389)
- binding uridine-diphosphate-n-acetylgalactosamine: Q289 (≠ D241), R322 (= R274), G334 (= G286), G424 (= G376), T426 (≠ C378), S434 (≠ A386), T437 (= T389), C439 (≠ A391), G440 (= G392), V441 (≠ S393), H442 (≠ Y394)
6r4eA Crystal structure of human gfat-1 in complex with glucose-6-phosphate and l-glu (see paper)
40% identity, 100% coverage: 2:613/613 of query aligns to 1:663/663 of 6r4eA
- active site: L7 (≠ V8), R32 (= R27), W95 (= W75), N122 (= N101), G123 (= G102), E536 (= E486), K540 (= K490), E543 (= E493), H559 (= H509), K658 (= K608)
- binding glucose-6-phosphate: T358 (= T307), S359 (= S308), S403 (= S352), Q404 (= Q353), S405 (= S354), T408 (= T357), S456 (= S405), K540 (= K490), E543 (= E493)
- binding glutamic acid: C1 (= C2), R94 (= R74), W95 (= W75), T97 (= T77), G123 (= G102), D147 (= D126)
6r4gA Crystal structure of human gfat-1 in complex with udp-glcnac (see paper)
40% identity, 99% coverage: 2:606/613 of query aligns to 1:652/652 of 6r4gA
- active site: L7 (≠ V8), R32 (= R27), W95 (= W75), N122 (= N101), G123 (= G102), E532 (= E486), K536 (= K490), E539 (= E493), H555 (= H509)
- binding glucose-6-phosphate: G353 (= G306), T354 (= T307), S355 (= S308), S399 (= S352), Q400 (= Q353), S401 (= S354), T404 (= T357), S452 (= S405), E539 (= E493)
- binding magnesium ion: S433 (≠ A386), R434 (= R387), T436 (= T389)
- binding uridine-diphosphate-n-acetylglucosamine: Q288 (≠ D241), R321 (= R274), G333 (= G286), G423 (= G376), T425 (≠ C378), S433 (≠ A386), T436 (= T389), C438 (≠ A391), G439 (= G392), V440 (≠ S393), H441 (≠ Y394)
P14742 Glutamine--fructose-6-phosphate aminotransferase [isomerizing]; GFAT; D-fructose-6-phosphate amidotransferase; Hexosephosphate aminotransferase; EC 2.6.1.16 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
44% identity, 71% coverage: 176:613/613 of query aligns to 278:717/717 of P14742
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 active site, For GATase activity
Q06210 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1; D-fructose-6-phosphate amidotransferase 1; Glutamine:fructose-6-phosphate amidotransferase 1; GFAT 1; GFAT1; Hexosephosphate aminotransferase 1; EC 2.6.1.16 from Homo sapiens (Human) (see paper)
43% identity, 69% coverage: 190:613/613 of query aligns to 274:699/699 of Q06210
2zj4A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
44% identity, 60% coverage: 249:613/613 of query aligns to 2:365/365 of 2zj4A
- active site: E238 (= E486), K242 (= K490), E245 (= E493), H261 (= H509), K360 (= K608)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T60 (= T307), S61 (= S308), S105 (= S352), Q106 (= Q353), S107 (= S354), T110 (= T357), V156 (= V403), A157 (= A404), K242 (= K490), E245 (= E493)
2zj3A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
44% identity, 60% coverage: 249:613/613 of query aligns to 2:365/365 of 2zj3A
- active site: E238 (= E486), K242 (= K490), E245 (= E493), H261 (= H509), K360 (= K608)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T307), S61 (= S308), S105 (= S352), Q106 (= Q353), S107 (= S354), T110 (= T357), V156 (= V403), A359 (= A607), K360 (= K608)
1morA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucose 6-phosphate (see paper)
46% identity, 60% coverage: 248:613/613 of query aligns to 2:366/366 of 1morA
- active site: E239 (= E486), K243 (= K490), E246 (= E493), H262 (= H509), K361 (= K608)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T307), S105 (= S352), Q106 (= Q353), S107 (= S354), T110 (= T357), V157 (= V403), A360 (= A607), K361 (= K608)
1moqA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucosamine 6-phosphate (see paper)
46% identity, 60% coverage: 248:613/613 of query aligns to 2:366/366 of 1moqA
- active site: E239 (= E486), K243 (= K490), E246 (= E493), H262 (= H509), K361 (= K608)
- binding 2-amino-2-deoxy-6-O-phosphono-alpha-D-glucopyranose: T60 (= T307), S61 (= S308), S105 (= S352), Q106 (= Q353), S107 (= S354), T110 (= T357), V157 (= V403), A360 (= A607), K361 (= K608)
1mosA Isomerase domain of glucosamine 6-phosphate synthase complexed with 2- amino-2-deoxyglucitol 6-phosphate (see paper)
46% identity, 60% coverage: 248:613/613 of query aligns to 3:367/367 of 1mosA
- active site: E240 (= E486), K244 (= K490), E247 (= E493), H263 (= H509), K362 (= K608)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T61 (= T307), S62 (= S308), S106 (= S352), Q107 (= Q353), S108 (= S354), T111 (= T357), K244 (= K490), E247 (= E493)
7dnrA Crystal structure of zn-bound sis domain of glucosamine-6-p synthase from e. Coli
45% identity, 58% coverage: 248:604/613 of query aligns to 2:357/357 of 7dnrA
2v4mA The isomerase domain of human glutamine-fructose-6-phosphate transaminase 1 (gfpt1) in complex with fructose 6-phosphate
42% identity, 58% coverage: 249:601/613 of query aligns to 1:352/352 of 2v4mA
- active site: E237 (= E486), K241 (= K490), E244 (= E493), H260 (= H509)
- binding fructose -6-phosphate: T59 (= T307), S60 (= S308), S104 (= S352), Q105 (= Q353), S106 (= S354), T109 (= T357), A156 (= A404), S157 (= S405), K241 (= K490), E244 (= E493)
2pocB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
44% identity, 57% coverage: 252:601/613 of query aligns to 2:352/352 of 2pocB
- active site: E236 (= E486), K240 (= K490), E243 (= E493), H259 (= H509)
- binding 6-O-phosphono-beta-D-glucopyranose: C55 (= C305), T57 (= T307), S58 (= S308), S102 (= S352), Q103 (= Q353), S104 (= S354), T107 (= T357), E243 (= E493)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (= R274), G36 (= G286), G126 (= G376), V128 (≠ C378), S136 (≠ A386), T139 (= T389), C141 (≠ A391), G142 (= G392), V143 (≠ S393), H144 (≠ Y394)
2putA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
42% identity, 57% coverage: 252:601/613 of query aligns to 2:339/339 of 2putA
- active site: E236 (= E486), K240 (= K490), E243 (= E493)
- binding fructose -6-phosphate: C55 (= C305), T57 (= T307), S102 (= S352), Q103 (= Q353), S104 (= S354), T107 (= T357), A154 (= A404), S155 (= S405), K240 (= K490)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (= R274), G36 (= G286), G126 (= G376), V128 (≠ C378), S136 (≠ A386), T139 (= T389), C141 (≠ A391), G142 (= G392), V143 (≠ S393), H144 (≠ Y394)
2puvA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
42% identity, 57% coverage: 250:601/613 of query aligns to 1:338/338 of 2puvA
- active site: E237 (= E486), K241 (= K490), E244 (= E493)
- binding 5-amino-5-deoxy-1-o-phosphono-d-mannitol: C56 (= C305), T58 (= T307), S103 (= S352), Q104 (= Q353), S105 (= S354), T108 (= T357), A155 (= A404), E244 (= E493)
- binding uridine-diphosphate-n-acetylglucosamine: R25 (= R274), G37 (= G286), G127 (= G376), V129 (≠ C378), S137 (≠ A386), T140 (= T389), C142 (≠ A391), G143 (= G392), V144 (≠ S393), H145 (≠ Y394)
2puwB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
42% identity, 57% coverage: 252:601/613 of query aligns to 2:331/331 of 2puwB
1xfgA Glutaminase domain of glucosamine 6-phosphate synthase complexed with l-glu hydroxamate (see paper)
45% identity, 37% coverage: 2:225/613 of query aligns to 1:221/238 of 1xfgA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W75), N98 (= N101), G99 (= G102)
- binding glutamine hydroxamate: C1 (= C2), R73 (= R74), W74 (= W75), T76 (= T77), H86 (= H87), N98 (= N101), G99 (= G102), D123 (= D126)
Query Sequence
>Echvi_1524 FitnessBrowser__Cola:Echvi_1524
MCGIVAYVGKQEALPVIIKGLKRLEYRGYDSAGVALLNDAGLNVYKKKGKVSELENFIES
NPNLHSHIGIGHTRWATHGEPNDANAHPHYSASENFAMIHNGIIENYEVLKTDLINKGYT
FHSDTDSEVFINFIEDIYQNNNCSLEEAVRLALHKIVGAYAIVLMNKEEPDTLIAARKGS
PLVIGVGEDEFFLASDATPIVEYTNQVVYLDDYEIAVIRDAKLQIKTIENVETHPYINKL
DMELEAIEKGGYEHFMLKEINEQPRSIADCMRGRLDSRAGRLILGGLRDYMNKFQNADRI
IITACGTSWHAGLVAEYLFEEFARVPVEVEYASEFRYRNPVINSRDFVIAISQSGETADT
LAAIELAKQKGATIFGVCNVVGSSIARATHAGSYTHAGPEIGVASTKAFTAQISVLSMMA
LMLGYQRGTLPESKYMELLSELEAIPAKVEKALKLNEQIERIAAQYKDARNFLYLGRGYN
FPVALEGALKLKEISYIHAEGYPAAEMKHGPIALIDEEMPVVFIATQDSSYEKVVSNIQE
VKARKGKIIAVVTEGDQTVRKMADHVIEIPRAHEAFVPLISVLPLQQLSYHIAVMRGCNV
DQPRNLAKSVTVE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory