SitesBLAST
Comparing Echvi_1572 FitnessBrowser__Cola:Echvi_1572 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3m4rA Structure of the n-terminal class ii aldolase domain of a conserved protein from thermoplasma acidophilum
32% identity, 31% coverage: 15:233/702 of query aligns to 6:213/213 of 3m4rA
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
33% identity, 36% coverage: 442:695/702 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G451), M16 (≠ I456), D35 (= D475), I36 (= I476), I62 (≠ V500), N88 (≠ C526), G90 (= G528), I138 (= I577), S140 (= S579), Y152 (= Y592), K156 (= K596), I185 (≠ V625)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
33% identity, 36% coverage: 442:695/702 of query aligns to 3:242/248 of Q9KJF1
- S15 (≠ G454) binding
- D36 (= D475) binding
- D62 (= D499) binding
- I63 (≠ V500) binding
- N89 (≠ C526) binding
- Y153 (= Y592) binding
- K157 (= K596) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
36% identity, 26% coverage: 442:626/702 of query aligns to 3:191/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G451), Q15 (≠ G454), G16 (= G455), I17 (= I456), D36 (= D475), V63 (= V500), N89 (≠ C526), A91 (≠ G528), S94 (≠ I531), I142 (= I577), S143 (≠ A578), S144 (= S579), Y157 (= Y592), K161 (= K596), P187 (= P622), H188 (≠ D623), I190 (≠ V625)
Sites not aligning to the query:
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
34% identity, 36% coverage: 442:696/702 of query aligns to 5:255/258 of 3ak4A
- active site: G18 (= G455), S141 (= S579), L151 (≠ N589), Y154 (= Y592), K158 (= K596), E199 (= E633)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ G454), G18 (= G455), I19 (= I456), D38 (= D475), L39 (≠ I476), V60 (≠ M498), D61 (= D499), V62 (= V500), N88 (≠ C526), A89 (= A527), G90 (= G528), T139 (≠ I577), S141 (= S579), Y154 (= Y592), K158 (= K596), G185 (vs. gap), V187 (vs. gap), T189 (≠ D623), M191 (≠ V625)
1gegE Cryatal structure analysis of meso-2,3-butanediol dehydrogenase (see paper)
35% identity, 36% coverage: 444:696/702 of query aligns to 2:253/256 of 1gegE
- active site: G13 (= G455), S139 (= S579), Y152 (= Y592), K156 (= K596), V197 (≠ R640)
- binding alpha-D-glucopyranose: R63 (≠ G503), D64 (= D504), F67 (≠ I507), E123 (= E563)
- binding nicotinamide-adenine-dinucleotide: G9 (= G451), Q12 (≠ G454), I14 (= I456), D33 (= D475), Y34 (≠ I476), V58 (≠ M498), D59 (= D499), V60 (= V500), N86 (≠ C526), A87 (= A527), I109 (= I549), S139 (= S579), Y152 (= Y592), K156 (= K596), P182 (= P622), V185 (≠ E627), T187 (≠ S629), M189 (≠ I631)
3rwbA Crystal structure of complex of 4pal (4-pyridoxolactone) and pldh (tetrameric pyridoxal 4-dehydrogenase) from mesorhizobium loti
34% identity, 36% coverage: 442:696/702 of query aligns to 4:244/247 of 3rwbA
- active site: G17 (= G455), S140 (= S579), Y153 (= Y592), K157 (= K596)
- binding 7-hydroxy-6-methylfuro[3,4-c]pyridin-1(3H)-one: S140 (= S579), N141 (≠ K580), T142 (≠ N581), M150 (≠ N589), Y153 (= Y592), L185 (≠ V625), H196 (≠ R640)
- binding nicotinamide-adenine-dinucleotide: G13 (= G451), Q16 (≠ G454), G17 (= G455), I18 (= I456), D37 (= D475), I38 (= I476), D60 (= D499), I61 (≠ V500), N87 (≠ C526), A88 (= A527), S89 (≠ G528), I138 (= I577), S140 (= S579), Y153 (= Y592), K157 (= K596), P183 (= P622), L185 (≠ V625), I186 (= I626), S188 (≠ G628), G190 (= G634), V191 (≠ E635)
3ndrA Crystal structure of tetrameric pyridoxal 4-dehydrogenase from mesorhizobium loti
34% identity, 36% coverage: 442:696/702 of query aligns to 4:244/247 of 3ndrA
- active site: G17 (= G455), S140 (= S579), Y153 (= Y592), K157 (= K596)
- binding nicotinamide-adenine-dinucleotide: G13 (= G451), Q16 (≠ G454), G17 (= G455), I18 (= I456), D37 (= D475), I38 (= I476), D60 (= D499), I61 (≠ V500), N87 (≠ C526), A88 (= A527), S89 (≠ G528), V110 (≠ I549), I138 (= I577), S140 (= S579), Y153 (= Y592), K157 (= K596), P183 (= P622), L185 (≠ V625), I186 (= I626), S188 (≠ G628), G190 (= G634), V191 (≠ E635)
Q48436 Diacetyl reductase [(S)-acetoin forming]; Acetoin(diacetyl) reductase; AR; Meso-2,3-butanediol dehydrogenase; EC 1.1.1.304 from Klebsiella pneumoniae (see paper)
34% identity, 36% coverage: 444:696/702 of query aligns to 2:253/256 of Q48436
- 6:33 (vs. 448:475, 57% identical) binding
- D59 (= D499) binding
- K156 (= K596) binding
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
29% identity, 37% coverage: 442:698/702 of query aligns to 5:254/255 of 5itvA
- active site: G18 (= G455), S141 (= S579), Y154 (= Y592), K158 (= K596)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G451), S17 (≠ G454), G18 (= G455), I19 (= I456), D38 (= D475), I39 (= I476), T61 (≠ M498), I63 (≠ V500), N89 (≠ C526), G91 (= G528), T139 (≠ I577), S141 (= S579), Y154 (= Y592), K158 (= K596), P184 (= P622), G185 (≠ D623), I186 (≠ A624), I187 (≠ V625)
8dt1C Crystal structure of a putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 in complex with NAD
40% identity, 26% coverage: 442:622/702 of query aligns to 2:184/259 of 8dt1C
- binding nicotinamide-adenine-dinucleotide: G11 (= G451), S14 (≠ G454), G15 (= G455), I16 (= I456), D35 (= D475), L36 (≠ I476), M60 (= M498), V62 (= V500), N88 (≠ C526), A89 (= A527), M139 (≠ I577), Y154 (= Y592), K158 (= K596), P184 (= P622)
Sites not aligning to the query:
7ejhA Crystal structure of kred mutant-f147l/l153q/y190p/l199a/m205f/m206f and 2-hydroxyisoindoline-1,3-dione complex
36% identity, 26% coverage: 442:622/702 of query aligns to 6:189/253 of 7ejhA
- binding 2-oxidanylisoindole-1,3-dione: S144 (= S579), I145 (≠ K580), E146 (≠ N581), Y157 (= Y592)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G451), T17 (≠ A453), I20 (= I456), R40 (≠ I476), H41 (≠ N477), D64 (= D504), A65 (≠ D505), N91 (≠ C526), A92 (= A527), V114 (≠ I549), M142 (≠ I577), S144 (= S579), Y157 (= Y592), K161 (= K596), P189 (= P622)
Sites not aligning to the query:
7ejiB Crystal structure of kred f147l/l153q/y190p/l199a/m205f/m206f variant and methyl methacrylate complex
36% identity, 26% coverage: 442:622/702 of query aligns to 4:187/251 of 7ejiB
- binding methyl 2-methylprop-2-enoate: S142 (= S579), I143 (≠ K580), Y155 (= Y592)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G451), T15 (≠ A453), L16 (≠ G454), G17 (= G455), I18 (= I456), R38 (≠ I476), H39 (≠ N477), D62 (= D504), A63 (≠ D505), N89 (≠ C526), A90 (= A527), V112 (≠ I549), M140 (≠ I577), S142 (= S579), Y155 (= Y592), K159 (= K596), P187 (= P622)
Sites not aligning to the query:
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
32% identity, 37% coverage: 442:698/702 of query aligns to 5:260/261 of 6zzsD
- active site: G18 (= G455), S143 (= S579), Y156 (= Y592)
- binding nicotinamide-adenine-dinucleotide: G14 (= G451), S17 (≠ G454), I19 (= I456), D38 (= D475), M39 (≠ I476), D64 (= D499), V65 (= V500), N91 (≠ C526), A92 (= A527), G93 (= G528), M141 (≠ I577), A142 (= A578), S143 (= S579), Y156 (= Y592), K160 (= K596), P186 (= P622), G187 (≠ D623), V189 (= V625), T191 (≠ S629), L193 (≠ I631)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ A530), S143 (= S579), N145 (= N581), K153 (≠ N589), Y156 (= Y592), Q197 (≠ E635)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
32% identity, 37% coverage: 442:698/702 of query aligns to 4:259/260 of 6zzqA
- active site: G17 (= G455), S142 (= S579), Y155 (= Y592)
- binding acetoacetic acid: Q94 (≠ A530), S142 (= S579), K152 (≠ N589), Y155 (= Y592), Q196 (≠ E635)
- binding nicotinamide-adenine-dinucleotide: G13 (= G451), S16 (≠ G454), G17 (= G455), I18 (= I456), D37 (= D475), M38 (≠ I476), D63 (= D499), V64 (= V500), N90 (≠ C526), A91 (= A527), G92 (= G528), M140 (≠ I577), A141 (= A578), S142 (= S579), Y155 (= Y592), K159 (= K596), Y187 (≠ A624), V188 (= V625), T190 (≠ S629)
6zzpA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with NAD+ and 3-oxovalerate (see paper)
33% identity, 33% coverage: 439:672/702 of query aligns to 5:238/265 of 6zzpA
- binding nicotinamide-adenine-dinucleotide: G17 (= G451), S20 (≠ G454), G21 (= G455), I22 (= I456), D41 (= D475), I42 (= I476), M66 (= M498), D67 (= D499), V68 (= V500), N94 (≠ C526), A95 (= A527), G96 (= G528), M145 (≠ I577), S147 (= S579), Y160 (= Y592), K164 (= K596), P190 (= P622), F192 (≠ A624), V193 (= V625), T195 (≠ S629), L197 (≠ I631), V198 (≠ W632)
- binding 3-oxidanylidenepentanoic acid: Q98 (≠ A530), S147 (= S579), H149 (≠ N581), K157 (≠ N589), Y160 (= Y592), F192 (≠ A624), Q201 (≠ E635)
6zzoC Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with NAD+ and acetoacetate (see paper)
33% identity, 33% coverage: 439:672/702 of query aligns to 5:238/265 of 6zzoC
- binding acetoacetic acid: Q98 (≠ A530), H149 (≠ N581), K157 (≠ N589), F192 (≠ A624), Q201 (≠ E635)
- binding nicotinamide-adenine-dinucleotide: G17 (= G451), S20 (≠ G454), G21 (= G455), I22 (= I456), D41 (= D475), I42 (= I476), M66 (= M498), D67 (= D499), V68 (= V500), N94 (≠ C526), A95 (= A527), G96 (= G528), M145 (≠ I577), Y160 (= Y592), K164 (= K596), P190 (= P622), F192 (≠ A624), V193 (= V625), T195 (≠ S629), L197 (≠ I631), V198 (≠ W632)
Q6WVP7 NADP-dependent (R)-specific alcohol dehydrogenase; (R)-specific ADH; Ketoreductase; KRED; EC 1.1.1.- from Lentilactobacillus kefiri (Lactobacillus kefiri) (see paper)
36% identity, 26% coverage: 442:622/702 of query aligns to 5:188/252 of Q6WVP7
Sites not aligning to the query:
- 191:195 binding
- 252 binding
F1SWA0 Zerumbone synthase; EC 1.1.1.326 from Zingiber zerumbet (Shampoo ginger) (Amomum zerumbet) (see paper)
38% identity, 26% coverage: 442:625/702 of query aligns to 3:188/267 of F1SWA0
- S142 (= S579) mutation to A: Strong reduction in oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- S144 (≠ N581) mutation to A: Increased oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- Y155 (= Y592) mutation to A: Strong reduction in oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- K159 (= K596) mutation to A: Abolishes all oxidoreductase activity.
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
33% identity, 36% coverage: 441:696/702 of query aligns to 2:245/247 of 4jroC
- active site: G16 (= G455), S142 (= S579), Q152 (≠ N589), Y155 (= Y592), K159 (= K596)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G451), S14 (≠ A453), R15 (≠ G454), G16 (= G455), I17 (= I456), N35 (vs. gap), Y36 (vs. gap), N37 (vs. gap), G38 (vs. gap), S39 (≠ T474), N63 (≠ D499), V64 (= V500), N90 (≠ C526), A91 (= A527), I93 (≠ L529), I113 (= I549), S142 (= S579), Y155 (= Y592), K159 (= K596), P185 (= P622), I188 (≠ V625), T190 (≠ E627)
Query Sequence
>Echvi_1572 FitnessBrowser__Cola:Echvi_1572
MSTAERTFKHVNYLWDEQKAQELEGDEVALLIYRSNILGADLRITNYGGGNTSCKTTEVD
PLTKEETEVMWVKGSGGDIGTLKRSGLAGLYVEKLHSLKNVYRGLEFEDEMVGLFNHCIY
DLDSKAPSIDTPLHAFLPFKHIDHLHPDAAIAIAASKDGEKITEELFEGQIAWVPWQRPG
FDLALQLEKALNENPGIRGIMLGGHGLFTWGDTAYECYINSLEVIDKASEYLEQNYGKDR
PVFGGQKIESLAPEQRQEQASIIAPVLRGLASGYNRMVGHFTDDERVLQFANSHDLEKLA
PLGTSCPDHFLRTKIRPLVLDFPADVDLSKADEIKEKLDKDFEEYRAYYKKYYEDHKRDN
SPAMRDPNPVVIIWPGVGMFSYAKNKQTARVASEFYINAINVMRGAEAVSEYVALPLQEA
FDIEYWLLEEAKLQRMPKEQPLSRKVALVTGGAGGIGKAIADKLASEGACVFITDINQER
LDGAVATYSKDVGGGAVMDVTKGDDIIKAYKAAALKFGGVDIIVNCAGLAISKPIEQTSE
QDWDLLQDILVKGQFAVSKAGVETLRAQNLGGDIINIASKNALVSGPNNVGYGTAKAAQV
HMSRLLAAELGKDKIRVNVVNPDAVIEGSKIWEGEWAKGRAKAYGITVEELPAFYAKRTI
LNEIIGVDDIANGVFAFVGGHLSKCTGNILNVDGGVAAAFVR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory