SitesBLAST
Comparing Echvi_1580 FitnessBrowser__Cola:Echvi_1580 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8grjB Crystal structure of gamma-alpha subunit complex from burkholderia cepacia fad glucose dehydrogenase in complex with gluconolactone
26% identity, 83% coverage: 94:575/580 of query aligns to 77:531/531 of 8grjB
- binding fe3-s4 cluster: C204 (= C217), C205 (≠ F218), G206 (≠ F219), N207 (≠ C220), N209 (≠ Q222), C210 (= C223), C214 (= C227), P331 (≠ V351)
- binding flavin-adenine dinucleotide: Q86 (≠ F103), R89 (= R106), T94 (≠ R111), H97 (= H114), W98 (= W115), A99 (≠ G116), S101 (≠ I118), M211 (≠ N224), V242 (= V257), A277 (= A293), N278 (≠ S294), E281 (= E297), I285 (= I301), N467 (≠ T500), N511 (= N555), T513 (= T557)
- binding D-glucono-1,5-lactone: M211 (≠ N224), E333 (≠ G353), H355 (= H374), N466 (≠ D499), N467 (≠ T500), H468 (= H512), N511 (= N555)
Sites not aligning to the query:
7w2jD Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
24% identity, 97% coverage: 13:576/580 of query aligns to 4:537/537 of 7w2jD
- binding fe3-s4 cluster: R200 (= R214), C211 (= C217), G213 (≠ F219), N214 (≠ C220), N215 (= N221), C217 (= C223), C221 (= C227), I223 (≠ A229), A225 (= A231), S338 (≠ H355)
- binding flavin-adenine dinucleotide: G9 (= G18), G11 (= G20), D32 (≠ E41), A33 (= A42), Y59 (≠ A80), K97 (≠ R106), G101 (= G110), T102 (≠ R111), T103 (= T112), H105 (= H114), W106 (= W115), S109 (≠ I118), V249 (= V257), A284 (= A293), N285 (≠ S294), E288 (= E297), K291 (≠ R300), L292 (≠ I301), N472 (≠ R509), N516 (= N555), S517 (≠ P556), T518 (= T557)
- binding heme c: P209 (vs. gap), I223 (≠ A229)
8jejA Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
24% identity, 97% coverage: 13:576/580 of query aligns to 7:540/540 of 8jejA
- binding fe3-s4 cluster: R203 (= R214), C214 (= C217), C215 (≠ F218), G216 (≠ F219), N217 (≠ C220), N218 (= N221), N219 (≠ Q222), C220 (= C223), C224 (= C227), I226 (≠ A229), M229 (≠ D232), S341 (≠ H355)
- binding flavin-adenine dinucleotide: I11 (≠ V17), G12 (= G18), G14 (= G20), I15 (≠ A21), C16 (≠ G22), D35 (≠ E41), A36 (= A42), G97 (vs. gap), K100 (≠ R106), G101 (≠ M107), G104 (= G110), T105 (≠ R111), T106 (= T112), H108 (= H114), W109 (= W115), A110 (≠ G116), S112 (≠ I118), M221 (≠ N224), A250 (= A255), V252 (= V257), A287 (= A293), N288 (≠ S294), E291 (= E297), N475 (≠ R509), H476 (= H512), N519 (= N555), T521 (= T557), M524 (≠ I560)
7qf8A Crystal structure of a bacterial pyranose 2-oxidase from pseudoarthrobacter siccitolerans (see paper)
23% identity, 98% coverage: 11:578/580 of query aligns to 5:490/494 of 7qf8A
- binding flavin-adenine dinucleotide: V11 (= V17), G12 (= G18), G14 (= G20), P15 (≠ A21), T16 (≠ G22), E37 (= E41), V38 (≠ A42), S114 (= S105), G119 (= G110), M120 (≠ R111), W124 (= W115), T125 (≠ G116), A127 (≠ I118), V227 (= V257), G261 (= G292), A262 (= A293), D263 (≠ S294), R266 (≠ E297), P331 (≠ R396), L422 (≠ I511), H423 (= H512), N467 (= N555), T469 (= T557)
4migA Pyranose 2-oxidase from phanerochaete chrysosporium, recombinant wild type (see paper)
25% identity, 57% coverage: 244:575/580 of query aligns to 249:569/570 of 4migA
- binding dihydroflavine-adenine dinucleotide: C262 (≠ V257), C302 (≠ L291), A306 (= A295), L505 (≠ I511), N549 (= N555), T551 (= T557)
- binding 3-deoxy-3-fluoro-beta-D-glucopyranose: Q407 (≠ G415), D411 (= D419), Y415 (= Y423), A504 (≠ I510), H506 (= H512), N549 (= N555)
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 10, 11, 12, 31, 32, 128, 129, 130, 133, 134, 137, 138, 139, 141
- binding 3-deoxy-3-fluoro-beta-D-glucopyranose: 139
4mihA Pyranose 2-oxidase from phanerochaete chrysosporium, recombinant h158a mutant (see paper)
25% identity, 57% coverage: 244:575/580 of query aligns to 257:575/576 of 4mihA
- binding flavin-adenine dinucleotide: C270 (≠ V257), C310 (≠ L291), A314 (= A295), N555 (= N555), P556 (= P556), T557 (= T557)
- binding 3-deoxy-3-fluoro-beta-D-glucopyranose: Q413 (≠ G415), D417 (= D419), Y421 (= Y423), A510 (≠ I510), H512 (= H512), N555 (= N555)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 22, 23, 24, 43, 44, 136, 137, 138, 141, 142, 146, 147, 149
4mifB Pyranose 2-oxidase from phanerochaete chrysosporium, wild type from natural source (see paper)
29% identity, 24% coverage: 434:575/580 of query aligns to 445:580/581 of 4mifB
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 10, 11, 12, 31, 32, 138, 142, 143, 146, 147, 148, 149, 150, 271, 312, 313, 316
7qvaA Crystal structure of a bacterial pyranose 2-oxidase in complex with mangiferin (see paper)
27% identity, 29% coverage: 412:578/580 of query aligns to 295:455/457 of 7qvaA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 12, 14, 15, 16, 36, 37, 38, 97, 102, 103, 106, 107, 108, 110, 206, 207, 241, 242, 243, 246
- binding Mangiferin: 51, 73, 108
7qfdA Crystal structure of a bacterial pyranose 2-oxidase complex with d- glucose (see paper)
28% identity, 27% coverage: 424:578/580 of query aligns to 308:456/458 of 7qfdA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 14, 15, 16, 36, 37, 38, 101, 106, 107, 111, 112, 114, 210, 211, 246, 250
- binding alpha-D-glucopyranose: 77, 112
4mofA Pyranose 2-oxidase h450g mutant with 2-fluorinated glucose (see paper)
27% identity, 24% coverage: 434:571/580 of query aligns to 430:564/573 of 4mofA
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 7, 10, 11, 12, 31, 32, 113, 114, 118, 119, 122, 123, 124, 126, 238, 275, 279, 409
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: 124, 403, 407, 411, 429
4mooA Pyranose 2-oxidase h450g mutant with 2-fluorinated galactose (see paper)
27% identity, 24% coverage: 434:571/580 of query aligns to 433:567/576 of 4mooA
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 116, 121, 122, 125, 126, 127, 128, 129, 241, 278, 282
- binding 2-deoxy-2-fluoro-alpha-D-galactopyranose: 127, 406, 410, 412, 414, 432
4momA Pyranose 2-oxidase h450g mutant with 3-fluorinated galactose (see paper)
27% identity, 24% coverage: 434:571/580 of query aligns to 433:567/576 of 4momA
Sites not aligning to the query:
- binding 3-deoxy-3-fluoro-beta-D-galactopyranose: 127, 406, 410, 414, 432
- binding dihydroflavine-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 116, 121, 122, 125, 126, 127, 129, 241, 278
4moeA Pyranose 2-oxidase h450g mutant with 3-fluorinated glucose (see paper)
27% identity, 24% coverage: 434:571/580 of query aligns to 433:567/576 of 4moeA
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 117, 121, 122, 125, 126, 127, 128, 129, 241, 278
- binding 3-deoxy-3-fluoro-beta-D-glucopyranose: 127, 406, 410, 412, 414
3lsmA Pyranose 2-oxidase h167a mutant with flavin n(5) sulfite adduct (see paper)
27% identity, 24% coverage: 434:571/580 of query aligns to 431:565/574 of 3lsmA
- binding (s)-10-((2s,3s,4r)-5-((s)-((s)-(((2r,3s,4r,5r)-5-(6-amino-9h-purin-9-yl)-3,4-dihydroxy-tetrahydrofuran-2-yl)methoxy)(hydroxy)phosphoryloxy)(hydroxy)phosphoryloxy)-2,3,4-trihydroxypentyl)-7,8-dimethyl-2,4-dioxo-2,3,4,4a-tetrahydrobenzo[g]pteridine-5(10h)-sulfonic acid: H504 (= H512), N549 (= N555), T551 (= T557)
- binding sulfite ion: R527 (≠ Q533), G530 (≠ E536), K532 (≠ D538)
Sites not aligning to the query:
- binding alpha-D-glucopyranose: 19, 20, 157, 161, 566
- binding (s)-10-((2s,3s,4r)-5-((s)-((s)-(((2r,3s,4r,5r)-5-(6-amino-9h-purin-9-yl)-3,4-dihydroxy-tetrahydrofuran-2-yl)methoxy)(hydroxy)phosphoryloxy)(hydroxy)phosphoryloxy)-2,3,4-trihydroxypentyl)-7,8-dimethyl-2,4-dioxo-2,3,4,4a-tetrahydrobenzo[g]pteridine-5(10h)-sulfonic acid: 11, 12, 13, 32, 33, 114, 119, 120, 124, 125, 126, 127, 239, 276, 280, 428
- binding sulfite ion: 249
4molA Pyranose 2-oxidase h167a mutant with 2-fluorinated galactose (see paper)
27% identity, 24% coverage: 434:571/580 of query aligns to 430:564/573 of 4molA
Sites not aligning to the query:
- binding 2-deoxy-2-fluoro-beta-D-galactopyranose: 403, 407, 409, 411, 427
- binding flavin-adenine dinucleotide: 7, 10, 11, 12, 31, 32, 113, 115, 118, 119, 123, 124, 126, 238, 275, 279
3pl8A Pyranose 2-oxidase h167a complex with 3-deoxy-3-fluoro-beta-d-glucose (see paper)
27% identity, 24% coverage: 434:571/580 of query aligns to 430:564/573 of 3pl8A
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 10, 11, 12, 31, 32, 113, 115, 118, 119, 123, 124, 126, 238, 275, 279
- binding 3-deoxy-3-fluoro-beta-D-glucopyranose: 124, 403, 407, 411
3bg6A Pyranose 2-oxidase from trametes multicolor, e542k mutant (see paper)
27% identity, 24% coverage: 434:571/580 of query aligns to 433:567/577 of 3bg6A
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 116, 117, 118, 121, 122, 125, 126, 127, 129, 241, 278, 282
2igoA Crystal structure of pyranose 2-oxidase h167a mutant with 2-fluoro-2- deoxy-d-glucose (see paper)
27% identity, 24% coverage: 434:571/580 of query aligns to 433:567/577 of 2igoA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 13, 14, 15, 34, 35, 116, 117, 118, 121, 122, 126, 127, 129, 241, 278
- binding 2-deoxy-2-fluoro-beta-D-glucopyranose: 127, 406
2f5vA Reaction geometry and thermostability mutant of pyranose 2-oxidase from the white-rot fungus peniophora sp. (see paper)
27% identity, 24% coverage: 434:571/580 of query aligns to 433:567/577 of 2f5vA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 13, 14, 15, 34, 35, 116, 121, 122, 125, 126, 127, 129, 241, 278, 282
- binding beta-D-arabino-hexopyranos-2-ulose: 127, 406, 410, 430, 432
1tt0A Crystal structure of pyranose 2-oxidase (see paper)
27% identity, 24% coverage: 434:571/580 of query aligns to 433:567/577 of 1tt0A
Sites not aligning to the query:
- binding acetate ion: 412
- binding flavin-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 116, 117, 118, 121, 122, 125, 126, 127, 129, 241, 278, 282
Query Sequence
>Echvi_1580 FitnessBrowser__Cola:Echvi_1580
MSFQIKSSGEAYDVIIVGSGAGGGMASKILSEAGFSVAVVEAGADFDPAKEEDRTQLRPP
WESPRRGASTRNRPFGDFDAAIGGWDIEGEPYTFEGDTKFDWFRSRMVGGRTNHWGRISL
RFGPNDFKRKDIDGLGDNWPIGYDDLKPYYDKVDKLIGVFGSKEGIYNEPDGFFLPPPKP
RLHELYIKKGADKIGVPVIPSRLSILTKPINNERGACFFCNQCNRACQAYADFSSGTCLV
KPAMKKGKVDLYTYAMVRKVTTDDKGKATGVSYISKVDMKEYKLRSRVVVLGASACESAR
IMLNSKSKNHPDGLANGSGMIGHYLHDSTGSDRMGFIPGLLDRKKYNEDGVGGMHVYTPW
WEDNSKLDFARGYHIEYWGGMSMPGYGFGFGMETIRQHIKDEFGNPGTSGGYGEGLKKDI
RAYFGTMVGMSGRGESIPRYENYCEIDNNTVDKYGIPVLKFNYNWTDQEVNQAKHMHDTF
EEVLTNAGAVIYGNKPGPDTQYGLLTPGRIIHEVGTTRMGNNPKTSVLNSNCQAHECDNL
FVVDGGPFVSQADKNPTWTILALAWRTSDYIVSELKKKNI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory