Comparing Echvi_1589 FitnessBrowser__Cola:Echvi_1589 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q86WA6 Valacyclovir hydrolase; VACVase; Valacyclovirase; Biphenyl hydrolase-like protein; Biphenyl hydrolase-related protein; Bph-rp; Breast epithelial mucin-associated antigen; MCNAA; EC 3.1.-.- from Homo sapiens (Human) (see 2 papers)
30% identity, 57% coverage: 180:422/424 of query aligns to 32:291/291 of Q86WA6
Sites not aligning to the query:
2ociA Crystal structure of valacyclovir hydrolase complexed with a product analogue (see paper)
30% identity, 54% coverage: 192:422/424 of query aligns to 6:254/254 of 2ociA
2ocgA Crystal structure of human valacyclovir hydrolase (see paper)
30% identity, 54% coverage: 192:422/424 of query aligns to 6:254/254 of 2ocgA
7c4dA Marine microorganism esterase (see paper)
30% identity, 53% coverage: 198:421/424 of query aligns to 2:261/261 of 7c4dA
Q9AQM4 2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoic acid hydrolase; HOPDA; EC 3.7.1.13 from Pseudomonas resinovorans (see paper)
27% identity, 54% coverage: 193:421/424 of query aligns to 21:279/290 of Q9AQM4
4lyeA Crystal structure of the s105a mutant of a c-c hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with substrate hopda (see paper)
26% identity, 54% coverage: 191:421/424 of query aligns to 8:273/276 of 4lyeA
4lxiA Crystal structure of the s105a mutant of a carbon-carbon bond hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with 5, 8-dif hopda (see paper)
26% identity, 54% coverage: 191:421/424 of query aligns to 8:273/276 of 4lxiA
4lxhA Crystal structure of the s105a mutant of a carbon-carbon bond hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with 3- cl hopda (see paper)
26% identity, 54% coverage: 191:421/424 of query aligns to 8:273/276 of 4lxhA
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
27% identity, 54% coverage: 194:421/424 of query aligns to 5:257/262 of 6eb3C
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
24% identity, 54% coverage: 194:421/424 of query aligns to 5:260/265 of 6eb3A
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
27% identity, 54% coverage: 194:421/424 of query aligns to 5:263/268 of 6eb3B
6kxhB Alp1u_y247f mutant in complex with fluostatin c (see paper)
31% identity, 33% coverage: 162:303/424 of query aligns to 1:133/294 of 6kxhB
Sites not aligning to the query:
3b12A Crystal structure of the fluoroacetate dehalogenase d104 mutant from burkholderia sp. Fa1 in complex with fluoroacetate (see paper)
37% identity, 24% coverage: 206:305/424 of query aligns to 23:127/294 of 3b12A
Sites not aligning to the query:
Q1JU72 Fluoroacetate dehalogenase; EC 3.8.1.3 from Burkholderia sp. (see paper)
37% identity, 24% coverage: 206:305/424 of query aligns to 23:127/304 of Q1JU72
Sites not aligning to the query:
4b9eA Structure of a putative epoxide hydrolase from pseudomonas aeruginosa, with bound mfa. (see paper)
34% identity, 28% coverage: 206:325/424 of query aligns to 25:144/297 of 4b9eA
Sites not aligning to the query:
5alrA Ligand complex structure of soluble epoxide hydrolase (see paper)
27% identity, 50% coverage: 198:407/424 of query aligns to 247:458/542 of 5alrA
Sites not aligning to the query:
2d0dA Crystal structure of a meta-cleavage product hydrolase (cumd) a129v mutant (see paper)
25% identity, 56% coverage: 186:421/424 of query aligns to 1:268/271 of 2d0dA
7a7gA Soluble epoxide hydrolase in complex with tk90 (see paper)
27% identity, 50% coverage: 198:407/424 of query aligns to 20:233/317 of 7a7gA
Sites not aligning to the query:
4nvrA 2.22 angstrom resolution crystal structure of a putative acyltransferase from salmonella enterica
28% identity, 46% coverage: 196:388/424 of query aligns to 23:232/302 of 4nvrA
Sites not aligning to the query:
5fp0A Ligand complex structure of soluble epoxide hydrolase (see paper)
27% identity, 50% coverage: 198:407/424 of query aligns to 247:459/543 of 5fp0A
Sites not aligning to the query:
>Echvi_1589 FitnessBrowser__Cola:Echvi_1589
MTKAIFAATVLLFLGIFQLTSAQQPYAGVVQSIDIQDYQGKKFTFTALTKYKSSNQMIGF
AAYYDDQGRFLANHLGDGPAPMEGREWQMLTLSGKINKKAAKLLVGVLCQGKGAFSLDDM
TLSIKGQPNDSLLLVNGNLEQHEVGVSAFISLNKDDSISITPSPLKKDNHILKLITNEES
TAIGSNKNAGKRVNANGVALYYETYGKGDPLLLLHGADMSIASFNRIIPILAKHYKVIAL
DTRGHGQSSEDGKKLTYELYAEDVNAFLDELGLEAVNVLGWSDGGNTGLILAMNHPDKVK
SLAAMAAVLYNDKSSVDPQVNKILSKQIKALENGALTDREAFSLRVKKSLLTEPNISPSS
LSKITCPALIMAGENDYVKEAHTKLIADHISDATLVTFKDTGHNAPLEIPKKFSEIVVNF
LKGN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory