Comparing Echvi_1669 FitnessBrowser__Cola:Echvi_1669 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7cwdA Crystal structure of beta-galactosidase ii from bacillus circulans in complex with beta-d-galactopyranosyl disaccharide (see paper)
45% identity, 94% coverage: 50:827/828 of query aligns to 4:802/803 of 7cwdA
5t99A Crystal structure of bugh2awt in complex with galactoisofagomine (see paper)
43% identity, 94% coverage: 50:824/828 of query aligns to 8:753/757 of 5t99A
4cu8A Unravelling the multiple functions of the architecturally intricate streptococcus pneumoniae beta-galactosidase, bgaa (see paper)
40% identity, 94% coverage: 46:826/828 of query aligns to 12:844/848 of 4cu8A
4cu7A Unravelling the multiple functions of the architecturally intricate streptococcus pneumoniae beta-galactosidase, bgaa (see paper)
40% identity, 94% coverage: 46:826/828 of query aligns to 12:844/848 of 4cu7A
4cucA Unravelling the multiple functions of the architecturally intricate streptococcus pneumoniae beta-galactosidase, bgaa. (see paper)
40% identity, 94% coverage: 46:826/828 of query aligns to 12:844/847 of 4cucA
7nitD X-ray structure of a multidomain bbgiii from bifidobacterium bifidum (see paper)
38% identity, 97% coverage: 28:827/828 of query aligns to 14:872/1253 of 7nitD
Sites not aligning to the query:
6qubA Truncated beta-galactosidase iii from bifidobacterium bifidum in complex with galactose
38% identity, 95% coverage: 43:827/828 of query aligns to 3:854/857 of 6qubA
5dmyA Beta-galactosidase - construct 33-930
37% identity, 95% coverage: 39:827/828 of query aligns to 1:852/855 of 5dmyA
6qudA 2-deoxy-galactose reaction intermediate of a truncated beta- galactosidase iii from bifidobacterium bifidum
38% identity, 95% coverage: 43:827/828 of query aligns to 3:834/837 of 6qudA
5t9gC Crystal structure of bugh2cwt in complex with galactoisofagomine (see paper)
34% identity, 94% coverage: 51:825/828 of query aligns to 2:809/811 of 5t9gC
T2KN75 Beta-glucuronidase; Glycosyl hydrolase 2 family protein P17; P17_GH2; Polysaccharide utilization locus H protein P17; PUL H protein P17; EC 3.2.1.31 from Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) (see paper)
27% identity, 94% coverage: 46:827/828 of query aligns to 25:796/981 of T2KN75
6hpdA The structure of a beta-glucuronidase from glycoside hydrolase family 2 (see paper)
27% identity, 94% coverage: 46:827/828 of query aligns to 7:778/955 of 6hpdA
6d50B Bacteroides uniforms beta-glucuronidase 2 bound to d-glucaro-1,5- lactone (see paper)
28% identity, 82% coverage: 46:721/828 of query aligns to 1:685/840 of 6d50B
6nzgA Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine (see paper)
28% identity, 82% coverage: 46:721/828 of query aligns to 1:685/837 of 6nzgA
5z1aA The crystal structure of bacteroides fragilis beta-glucuronidase in complex with uronic isofagomine
28% identity, 78% coverage: 47:688/828 of query aligns to 3:625/655 of 5z1aA
8dhlA Tannerella forsythia beta-glucuronidase (l2) (see paper)
27% identity, 84% coverage: 47:740/828 of query aligns to 3:677/827 of 8dhlA
Sites not aligning to the query:
8dhlB Tannerella forsythia beta-glucuronidase (l2) (see paper)
27% identity, 84% coverage: 47:740/828 of query aligns to 2:691/853 of 8dhlB
Sites not aligning to the query:
6mvfA Crystal structure of fmn-binding beta-glucuronidase from facaelibacterium prausnitzii l2-6 (see paper)
27% identity, 76% coverage: 47:676/828 of query aligns to 4:598/643 of 6mvfA
8getA R. Hominis 2 beta-glucuronidase bound to norquetiapine-glucuronide
25% identity, 81% coverage: 47:714/828 of query aligns to 2:631/639 of 8getA
6mvhA Crystal structure of fmn-binding beta-glucuronidase from roseburia hominis (see paper)
25% identity, 81% coverage: 47:714/828 of query aligns to 1:631/639 of 6mvhA
>Echvi_1669 FitnessBrowser__Cola:Echvi_1669
MSYFTYNFNGTVKGQIINTMQKFLSFILVFSLAVVSWNCASSEDKERQVIDFNYGWRFQL
GDHPNAISEDFDVSNWRELNLPHDWSIEGDFSEDHPTKPEGGALPAGIGWYRKAFKLPTE
AKEQSIWIEFDGVYRNGEVWINGHRLGKRPNGYSSFKYDLGEHLNYGDKVNVLAVRVDNS
EQPNSRWYTGSGIYRNVRLIRTGKVHVEHWGTYVTTPEITDSSAVVNLEVMVKNDGFNER
KLTVRSTILDADGEAVTEEEQPLVLGKGESTDVTQRFTVPSPKLWSTDEPYLYQVVTQVY
AGMQLMDDYVTPLGIRYFNFDAQKGFSLNGKRMKILGVCNHHDLGALGAAVNKRAIERRL
EILKEMGVNAIRTAHNPPAPELLQLCDEMGFIVQDEAFDVWKKKKVDADSHLFWDQWHRR
DLEDLILRDRNHPSIMMWSIGNEIREQFDSTGISITKELVRIVKELDTTRVVTCALTENI
PSKNFIYQSKALDLLGFNYKHKDHKNFPKWYPGEKLIATENMSALATRGHYDLPSDTIMR
WPQAHDKPLETGNEDLTVSAYDQVSAYWGSTHEETWKSIKDQDFMAGLFVWTGFDYLGEP
IPYPYPARSSYFGIVDLAGFPKDAYYMYQSEWTADTVLHVFPHWNWEAGQEVDVWAYYNQ
ADEVELFLNGESLGIKQKEGDDLHVMWRTPFEPGTLKAVARKDGKKVAEKKVTTAGDAQK
VTLSPDRKTIKADGKDLSFITVSICDMDGNIVPNADNMVNFEIQGEGKIMGVDNGYQASL
EPFKANYRKAFKGKCLLIVQSAREAGEISIRATSEHLQPGEIVLETVD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory