SitesBLAST
Comparing Echvi_1691 FitnessBrowser__Cola:Echvi_1691 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
1zh8A Crystal structure of oxidoreductase (tm0312) from thermotoga maritima at 2.50 a resolution
30% identity, 45% coverage: 6:159/345 of query aligns to 9:156/325 of 1zh8A
- active site: K98 (= K93)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G7), C11 (≠ A8), G12 (= G9), I13 (≠ G10), A14 (≠ I11), S37 (≠ D32), R38 (≠ L33), T39 (≠ D34), H42 (≠ N37), T74 (≠ A70), L75 (≠ V71), P76 (= P72), L79 (≠ A75), E97 (≠ Q92), K98 (= K93), N126 (≠ Q121)
Sites not aligning to the query:
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
26% identity, 75% coverage: 6:263/345 of query aligns to 6:262/332 of 2glxA
- active site: K93 (= K93), H179 (= H176)
- binding acetate ion: K93 (= K93), H179 (= H176)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G7), A8 (= A8), S9 (≠ G9), T10 (≠ G10), I11 (= I11), S32 (≠ D32), T33 (≠ L33), R37 (≠ N37), S69 (≠ V69), T70 (≠ A70), N72 (≠ P72), H75 (≠ A75), E92 (≠ Q92), K93 (= K93), H121 (≠ Q121), W161 (≠ F161), R162 (≠ L162)
Sites not aligning to the query:
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
25% identity, 75% coverage: 6:263/345 of query aligns to 7:263/333 of Q2I8V6
- ASTI 9:12 (≠ AGGI 8:11) binding
- S10 (≠ G9) mutation to G: Almost no effect.
- A13 (≠ V12) mutation to G: Can use NAD as cosubstrate as well as NADP.
- S33 (≠ D32) mutation to D: No activity.
- ST 33:34 (≠ DL 32:33) binding
- R38 (≠ N37) binding
- TTNELH 71:76 (≠ AVPGSA 70:75) binding
- EK 93:94 (≠ QK 92:93) binding
- K94 (= K93) mutation to G: Less than 1% remaining activity.
- N120 (= N119) binding
- WR 162:163 (≠ FL 161:162) binding
- D176 (≠ Y172) mutation to A: Less than 1% remaining activity.
- H180 (= H176) mutation to A: Less than 2% remaining activity.
- G206 (≠ Q203) mutation to I: No effect.
Sites not aligning to the query:
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
26% identity, 75% coverage: 6:263/345 of query aligns to 7:263/333 of 4koaA
- active site: K94 (= K93), H180 (= H176)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), A9 (= A8), S10 (≠ G9), T11 (≠ G10), I12 (= I11), S33 (≠ D32), S34 (≠ L33), R38 (≠ N37), T71 (≠ A70), N73 (≠ P72), H76 (≠ A75), K94 (= K93), Q160 (≠ W159)
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
25% identity, 65% coverage: 45:267/345 of query aligns to 48:292/340 of 4n54A
- active site: K96 (= K93), H183 (= H176)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: K96 (= K93), D156 (≠ Y153), D179 (≠ Y172), M180 (≠ H173), H183 (= H176), R238 (vs. gap), Y244 (≠ F231)
- binding 1,4-dihydronicotinamide adenine dinucleotide: S73 (≠ A70), P74 (≠ V71), F77 (≠ S74), H78 (≠ A75), E95 (≠ Q92), K96 (= K93), M125 (≠ Q121), F167 (≠ T164), F284 (≠ Y259)
Sites not aligning to the query:
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: 12
- binding 1,4-dihydronicotinamide adenine dinucleotide: 8, 9, 10, 11, 12, 13, 35, 36, 40
5uiaA Crystal structure of an oxidoreductase from agrobacterium radiobacter in complex with NAD+, r-2,3-dihydroxyisovalerate and magnesium
23% identity, 94% coverage: 16:339/345 of query aligns to 17:336/342 of 5uiaA
- binding (2S)-2,3-dihydroxy-3-methylbutanoic acid: K95 (= K93), Q162 (≠ W159), D175 (≠ Y172), H179 (= H176), Y229 (≠ H229)
- binding magnesium ion: W21 (≠ Y20), K22 (= K21), V24 (≠ I22), A27 (≠ F25)
- binding nicotinamide-adenine-dinucleotide: D34 (= D32), R35 (≠ L33), T72 (≠ V71), Q94 (= Q92), K95 (= K93), N123 (≠ Q121), Q162 (≠ W159), Y164 (≠ F161)
Sites not aligning to the query:
5ui9A Crystal structure of an oxidoreductase from agrobacterium radiobacter in complex with NAD+, 2 -hydroxy-2-hydroxymethyl propanoic acid and magnesium
23% identity, 94% coverage: 16:339/345 of query aligns to 17:336/342 of 5ui9A
- binding (2S)-2,3-dihydroxy-2-methylpropanoic acid: K95 (= K93), Q162 (≠ W159), D175 (≠ Y172), H179 (= H176), Y229 (≠ H229), W285 (= W280)
- binding magnesium ion: W21 (≠ Y20), K22 (= K21), V24 (≠ I22), A27 (≠ F25)
- binding nicotinamide-adenine-dinucleotide: D34 (= D32), R35 (≠ L33), T72 (≠ V71), S76 (≠ A75), Q94 (= Q92), K95 (= K93), P96 (= P94), N123 (≠ Q121), Q162 (≠ W159), Y164 (≠ F161)
Sites not aligning to the query:
5uhzA Crystal structure of an oxidoreductase from agrobacterium radiobacter in complex with NAD+, d-apionate and magnesium
23% identity, 94% coverage: 16:339/345 of query aligns to 17:336/342 of 5uhzA
- binding (3R,4R)-3,4-dihydroxy-4-(hydroxymethyl)oxolan-2-one: K95 (= K93), Q162 (≠ W159), D175 (≠ Y172), H179 (= H176), Y229 (≠ H229)
- binding magnesium ion: W21 (≠ Y20), K22 (= K21), V24 (≠ I22), A27 (≠ F25)
- binding nicotinamide-adenine-dinucleotide: D34 (= D32), R35 (≠ L33), T72 (≠ V71), S76 (≠ A75), Q94 (= Q92), K95 (= K93), P96 (= P94), N123 (≠ Q121), Q162 (≠ W159), Y164 (≠ F161)
Sites not aligning to the query:
5uhwA Crystal structure of an oxidoreductase from agrobacterium radiobacter in complex with NAD+ and magnesium
23% identity, 94% coverage: 16:339/345 of query aligns to 17:336/342 of 5uhwA
Sites not aligning to the query:
B9JK80 D-apiose dehydrogenase; EC 1.1.1.420 from Rhizobium rhizogenes (strain K84 / ATCC BAA-868) (Agrobacterium radiobacter)
23% identity, 94% coverage: 16:339/345 of query aligns to 20:339/345 of B9JK80
- W24 (≠ Y20) binding
- K25 (= K21) binding
- V27 (≠ I22) binding
- A30 (≠ F25) binding
- D37 (= D32) binding
- S79 (≠ A75) binding
- QK 97:98 (= QK 92:93) binding
- N126 (≠ Q121) binding
- QPY 165:167 (≠ WDF 159:161) binding
Sites not aligning to the query:
3q2kK Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
26% identity, 55% coverage: 6:195/345 of query aligns to 8:202/322 of 3q2kK
- active site: K95 (= K93), H183 (= H176)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R12 (≠ G10), K95 (= K93), T155 (≠ Y153), R156 (≠ T154), Y160 (≠ L158), N179 (≠ Y172), Q180 (≠ H173), H183 (= H176)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G7), G11 (= G9), R12 (≠ G10), I13 (= I11), D35 (= D34), T36 (≠ E35), T72 (≠ A70), P73 (≠ V71), S74 (≠ P72), L76 (≠ S74), H77 (≠ A75), E94 (≠ Q92), K95 (= K93), Q123 (= Q121), W166 (≠ T164), R167 (≠ A165), H183 (= H176)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 239
3q2kC Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
26% identity, 55% coverage: 6:195/345 of query aligns to 13:207/347 of 3q2kC
- active site: K100 (= K93), H188 (= H176)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R17 (≠ G10), K100 (= K93), W159 (≠ V152), T160 (≠ Y153), R161 (≠ T154), Y165 (≠ L158), N184 (≠ Y172), Q185 (≠ H173), H188 (= H176)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G9), R17 (≠ G10), I18 (= I11), D40 (= D34), T41 (≠ E35), A76 (≠ V69), T77 (≠ A70), S79 (≠ P72), H82 (≠ A75), Q85 (≠ E78), E99 (≠ Q92), K100 (= K93), Q128 (= Q121), W171 (≠ T164), R172 (≠ A165)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 243, 244
P04387 Galactose/lactose metabolism regulatory protein GAL80 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
22% identity, 47% coverage: 25:186/345 of query aligns to 47:212/435 of P04387
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
3btsB Crystal structure of a ternary complex of the transcriptional repressor gal80p (gal80s0 [g301r]) and the acidic activation domain of gal4p (aa 854-874) from saccharomyces cerevisiae with NAD (see paper)
22% identity, 47% coverage: 25:186/345 of query aligns to 33:198/390 of 3btsB
Sites not aligning to the query:
3m2tA The crystal structure of dehydrogenase from chromobacterium violaceum
22% identity, 57% coverage: 1:198/345 of query aligns to 4:203/342 of 3m2tA
- binding nicotinamide-adenine-dinucleotide: G10 (= G7), G12 (= G9), A13 (≠ G10), Q14 (≠ I11), D36 (= D32), S37 (≠ L33), R41 (≠ N37), A73 (≠ V69), G74 (≠ A70), L78 (≠ S74), E96 (≠ Q92), K97 (= K93), N125 (≠ Q121)
Sites not aligning to the query:
Query Sequence
>Echvi_1691 FitnessBrowser__Cola:Echvi_1691
MKILQIGAGGIVKDAHLPAYKIAGFEVEGVYDLDEENAISLATAFGIPRVFGSLDELTAH
ATEDTVFDVAVPGSAVLEVLEKLPDGAVVLIQKPMGEDLEAAKAILALCRKKKLKAGVNF
QMRYAPYIQKAREIIQAGHIGEVCDIEVKINVYTPWHLWDFLFTASRVEILYHSIHYVDL
VRSFFGNPEKVYAKTIKHPKMTQLASVKTNIIMDYGALKGANILTNHAHAFGLKHQQSYV
KIEGTKGAIMIEMGLLKNYPQGTADKFEYIIAAEGKEAEWKEVEIAGTWFPHAFIGSMTE
MKKALENPAYLPDNSVEDCIYTMACVEAAHQSSEQGGVVLPTIDQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory