Comparing Echvi_1769 FitnessBrowser__Cola:Echvi_1769 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q96PS8 Aquaporin-10; AQP-10; Aquaglyceroporin-10; Small intestine aquaporin from Homo sapiens (Human) (see 2 papers)
37% identity, 98% coverage: 5:242/244 of query aligns to 25:263/301 of Q96PS8
6f7hC Crystal structure of human aqp10 (see paper)
37% identity, 98% coverage: 5:242/244 of query aligns to 10:248/253 of 6f7hC
I1CR68 Aquaporin-1 from Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) (Mucormycosis agent) (Rhizopus arrhizus var. delemar) (see paper)
37% identity, 93% coverage: 4:231/244 of query aligns to 61:288/306 of I1CR68
3c02A X-ray structure of the aquaglyceroporin from plasmodium falciparum (see paper)
35% identity, 94% coverage: 4:232/244 of query aligns to 6:224/242 of 3c02A
8c9hA Aqp7_inhibitor
35% identity, 98% coverage: 4:242/244 of query aligns to 12:250/253 of 8c9hA
6n1gA Crystal structure of aquaglyceroporin aqp7 (see paper)
35% identity, 98% coverage: 4:242/244 of query aligns to 6:244/249 of 6n1gA
O14520 Aquaporin-7; AQP-7; Aquaglyceroporin-7; Aquaporin adipose; AQPap; Aquaporin-7-like from Homo sapiens (Human) (see 4 papers)
35% identity, 98% coverage: 4:242/244 of query aligns to 37:275/342 of O14520
Sites not aligning to the query:
1fx8A Crystal structure of the e. Coli glycerol facilitator (glpf) with substrate glycerol (see paper)
34% identity, 96% coverage: 5:239/244 of query aligns to 7:246/254 of 1fx8A
P0AER0 Glycerol uptake facilitator protein; Aquaglyceroporin; Glycerol facilitator from Escherichia coli (strain K12) (see 3 papers)
34% identity, 98% coverage: 5:242/244 of query aligns to 12:254/281 of P0AER0
B1VB61 Propanediol uptake facilitator PduF from Citrobacter freundii (see paper)
36% identity, 98% coverage: 5:242/244 of query aligns to 10:252/269 of B1VB61
P37451 Propanediol uptake facilitator PduF from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
35% identity, 96% coverage: 6:239/244 of query aligns to 11:249/264 of P37451
2evuA Crystal structure of aquaporin aqpm at 2.3a resolution (see paper)
30% identity, 98% coverage: 5:244/244 of query aligns to 9:245/245 of 2evuA
P43287 Aquaporin PIP2-2; Plasma membrane intrinsic protein 2-2; AtPIP2;2; Plasma membrane intrinsic protein 2b; PIP2b; TMP2b from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
31% identity, 95% coverage: 5:236/244 of query aligns to 40:261/285 of P43287
Sites not aligning to the query:
P08995 Nodulin-26; N-26 from Glycine max (Soybean) (Glycine hispida) (see paper)
32% identity, 93% coverage: 5:232/244 of query aligns to 41:241/271 of P08995
Sites not aligning to the query:
Q41870 Aquaporin PIP1-1; Plasma membrane intrinsic protein 1-1; ZmPIP1-1; ZmPIP1;1; ZmPIP1a from Zea mays (Maize) (see paper)
30% identity, 95% coverage: 5:236/244 of query aligns to 57:271/287 of Q41870
P61837 Aquaporin PIP1-1; AtPIP1;1; Plasma membrane aquaporin-1; Plasma membrane intrinsic protein 1a; PIP1a from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 95% coverage: 5:236/244 of query aligns to 55:270/286 of P61837
Sites not aligning to the query:
Q06611 Aquaporin PIP1-2; AtPIP1;2; Plasma membrane intrinsic protein 1b; PIP1b; Transmembrane protein A; AthH2; TMP-A from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 98% coverage: 5:242/244 of query aligns to 55:276/286 of Q06611
Sites not aligning to the query:
Q39196 Probable aquaporin PIP1-4; Plasma membrane intrinsic protein 1-4; AtPIP1;4; Transmembrane protein C; TMP-C from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 95% coverage: 5:236/244 of query aligns to 56:271/287 of Q39196
Sites not aligning to the query:
Q41951 Aquaporin TIP2-1; Delta-tonoplast intrinsic protein; Delta-TIP; Tonoplast intrinsic protein 2-1; AtTIP2;1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 96% coverage: 1:235/244 of query aligns to 18:228/250 of Q41951
Q08733 Aquaporin PIP1-3; AtPIP1;3; Plasma membrane intrinsic protein 1c; PIP1c; Transmembrane protein B; TMP-B from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 95% coverage: 5:236/244 of query aligns to 55:270/286 of Q08733
Sites not aligning to the query:
>Echvi_1769 FitnessBrowser__Cola:Echvi_1769
MNIYIAEFIGTGLLLLMGAGVVANVVLKQTKGNNSGWIVITTAWALGVFIGVVVAGPYSG
AHLNPAVSVGLAVAGLFEWSLVPGYVLAQILGAGAGSSLAWLIYKDHFDLTDDPNLKFAP
FATAPAIRNLSSNFLSEVVGTFVLILVILYSTGANLEDPNNTPIGLGALGALPVALLVWV
IGLALGGTTGYAINPARDLGPRLAHQFLPIKGKGSSDWAYSWVPIVGPLMGASLAAATFL
ILGS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory