SitesBLAST
Comparing Echvi_1847 FitnessBrowser__Cola:Echvi_1847 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8jejA Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
25% identity, 98% coverage: 7:555/559 of query aligns to 7:540/540 of 8jejA
- binding fe3-s4 cluster: R203 (≠ N209), C214 (= C220), C215 (≠ Q221), G216 (≠ A222), N217 (≠ R223), N218 (= N224), N219 (≠ K225), C220 (= C226), C224 (= C230), I226 (≠ F232), M229 (≠ Y235), S341 (≠ R354)
- binding flavin-adenine dinucleotide: I11 (≠ V11), G12 (= G12), G14 (= G14), I15 (= I15), C16 (≠ S16), D35 (≠ E35), A36 (≠ R36), G97 (vs. gap), K100 (vs. gap), G101 (vs. gap), G104 (= G111), T105 (≠ R112), T106 (≠ S113), H108 (≠ L115), W109 (= W116), A110 (≠ G117), S112 (≠ Q119), M221 (≠ W227), A250 (≠ S258), V252 (= V260), A287 (= A297), N288 (≠ S298), E291 (≠ N301), N475 (≠ I490), H476 (= H491), N519 (= N534), T521 (≠ S536), M524 (≠ Y539)
7w2jD Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
25% identity, 98% coverage: 7:555/559 of query aligns to 4:537/537 of 7w2jD
- binding fe3-s4 cluster: R200 (≠ N209), C211 (= C220), G213 (≠ A222), N214 (≠ R223), N215 (= N224), C217 (= C226), C221 (= C230), I223 (≠ F232), A225 (≠ G234), S338 (≠ R354)
- binding flavin-adenine dinucleotide: G9 (= G12), G11 (= G14), D32 (≠ E35), A33 (≠ R36), Y59 (= Y77), K97 (vs. gap), G101 (= G111), T102 (≠ R112), T103 (≠ S113), H105 (≠ L115), W106 (= W116), S109 (≠ Q119), V249 (= V260), A284 (= A297), N285 (≠ S298), E288 (≠ N301), K291 (≠ H304), L292 (≠ V305), N472 (≠ I490), N516 (= N534), S517 (≠ P535), T518 (≠ S536)
- binding heme c: P209 (= P218), I223 (≠ F232)
8grjB Crystal structure of gamma-alpha subunit complex from burkholderia cepacia fad glucose dehydrogenase in complex with gluconolactone
24% identity, 96% coverage: 21:554/559 of query aligns to 16:531/531 of 8grjB
- binding fe3-s4 cluster: C204 (= C220), C205 (≠ Q221), G206 (≠ A222), N207 (≠ R223), N209 (≠ K225), C210 (= C226), C214 (= C230), P331 (= P355)
- binding flavin-adenine dinucleotide: E30 (= E35), A31 (≠ R36), Q86 (≠ F104), R89 (≠ Y107), T94 (≠ R112), H97 (≠ L115), W98 (= W116), A99 (≠ G117), S101 (≠ Q119), M211 (≠ W227), V242 (≠ L264), A277 (= A297), N278 (≠ S298), E281 (≠ N301), I285 (≠ V305), N467 (≠ I490), N511 (= N534), T513 (≠ S536)
- binding D-glucono-1,5-lactone: M211 (≠ W227), E333 (vs. gap), H355 (≠ Y373), N466 (≠ G489), N467 (≠ I490), H468 (= H491), N511 (= N534)
Sites not aligning to the query:
7qvaA Crystal structure of a bacterial pyranose 2-oxidase in complex with mangiferin (see paper)
23% identity, 54% coverage: 258:559/559 of query aligns to 205:457/457 of 7qvaA
- binding flavin-adenine dinucleotide: L206 (≠ I259), V207 (= V260), G241 (≠ C296), A242 (= A297), D243 (≠ S298), R246 (≠ N301), L387 (≠ I490), H388 (= H491), N432 (= N534), T434 (≠ S536)
- binding Mangiferin: M299 (≠ K402), A385 (≠ Q488), S386 (≠ G489), H388 (= H491)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 12, 14, 15, 16, 36, 37, 38, 97, 102, 103, 106, 107, 108, 110
- binding Mangiferin: 51, 73, 108
7qf8A Crystal structure of a bacterial pyranose 2-oxidase from pseudoarthrobacter siccitolerans (see paper)
23% identity, 54% coverage: 258:559/559 of query aligns to 225:492/494 of 7qf8A
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 12, 14, 15, 16, 37, 38, 114, 119, 120, 124, 125, 127
7dveA Crystal structure of fad-dependent c-glycoside oxidase (see paper)
24% identity, 54% coverage: 251:554/559 of query aligns to 213:493/498 of 7dveA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 12, 14, 15, 16, 37, 38, 103, 108, 109, 112, 113, 114, 116
7qfdA Crystal structure of a bacterial pyranose 2-oxidase complex with d- glucose (see paper)
23% identity, 54% coverage: 258:559/559 of query aligns to 209:458/458 of 7qfdA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 14, 15, 16, 36, 37, 38, 101, 106, 107, 111, 112, 114
- binding alpha-D-glucopyranose: 77, 112
B5WWZ8 Long-chain-alcohol oxidase FAO1; Long-chain fatty alcohol oxidase 1; EC 1.1.3.20 from Lotus japonicus (Lotus corniculatus var. japonicus) (see paper)
32% identity, 12% coverage: 491:559/559 of query aligns to 681:749/749 of B5WWZ8
Sites not aligning to the query:
- 396 C→G: Loss of activity.
Q6UG02 Pyranose 2-oxidase; P2Ox; POD; POx; PROD; Pyranose oxidase; FAD-oxidoreductase; Glucose 2-oxidase; Pyranose:oxygen 2-oxidoreductase; EC 1.1.3.10 from Phlebiopsis gigantea (White-rot fungus) (Peniophora gigantea) (see paper)
26% identity, 25% coverage: 418:555/559 of query aligns to 475:612/622 of Q6UG02
- E540 (≠ T485) mutation to K: In P2OxB1; increases thermostability up to 70 degrees Celsius and enhances pH stability in alkaline solution. Increases the catalytic efficiency 3.1-fold for D-xylose and 7.3-fold for L-sorbose, mainly by lowering the Km values for these two substrates to 6.6 mM and 5.4 mM, respectively. In P2OxB2H; increases the catalytic efficiency 5.3-fold for D-glucose, 2-fold for methyl-beta-D-glucoside, 59.9-fold for D-xylose, 69-fold for L-sorbose and 4.8-fold for D-galactose; when associated with K-312.
Sites not aligning to the query:
- 167 H→C: Decreases activity by 90%.
- 312 K→E: In P2OxB2H; increases the catalytic efficiency 5.3-fold for D-glucose, 2-fold for methyl-beta-D-glucoside, 59.9-fold for D-xylose, 69-fold for L-sorbose and 4.8-fold for D-galactose; when associated with K-540.
4mofA Pyranose 2-oxidase h450g mutant with 2-fluorinated glucose (see paper)
27% identity, 24% coverage: 418:549/559 of query aligns to 429:563/573 of 4mofA
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 7, 10, 11, 12, 31, 32, 113, 114, 118, 119, 122, 123, 124, 126, 238, 275, 279, 409
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: 124, 403, 407, 411
4mooA Pyranose 2-oxidase h450g mutant with 2-fluorinated galactose (see paper)
27% identity, 24% coverage: 418:549/559 of query aligns to 432:566/576 of 4mooA
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 116, 121, 122, 125, 126, 127, 128, 129, 241, 278, 282
- binding 2-deoxy-2-fluoro-alpha-D-galactopyranose: 127, 406, 410, 412, 414
4momA Pyranose 2-oxidase h450g mutant with 3-fluorinated galactose (see paper)
27% identity, 24% coverage: 418:549/559 of query aligns to 432:566/576 of 4momA
Sites not aligning to the query:
- binding 3-deoxy-3-fluoro-beta-D-galactopyranose: 127, 406, 410, 414
- binding dihydroflavine-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 116, 121, 122, 125, 126, 127, 129, 241, 278
4moeA Pyranose 2-oxidase h450g mutant with 3-fluorinated glucose (see paper)
27% identity, 24% coverage: 418:549/559 of query aligns to 432:566/576 of 4moeA
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 117, 121, 122, 125, 126, 127, 128, 129, 241, 278
- binding 3-deoxy-3-fluoro-beta-D-glucopyranose: 127, 406, 410, 412, 414
3bg6A Pyranose 2-oxidase from trametes multicolor, e542k mutant (see paper)
27% identity, 24% coverage: 418:549/559 of query aligns to 432:566/577 of 3bg6A
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 116, 117, 118, 121, 122, 125, 126, 127, 129, 241, 278, 282
4molA Pyranose 2-oxidase h167a mutant with 2-fluorinated galactose (see paper)
27% identity, 24% coverage: 418:549/559 of query aligns to 429:563/573 of 4molA
Sites not aligning to the query:
- binding 2-deoxy-2-fluoro-beta-D-galactopyranose: 403, 407, 409, 411, 427
- binding flavin-adenine dinucleotide: 7, 10, 11, 12, 31, 32, 113, 115, 118, 119, 123, 124, 126, 238, 275, 279
3pl8A Pyranose 2-oxidase h167a complex with 3-deoxy-3-fluoro-beta-d-glucose (see paper)
27% identity, 24% coverage: 418:549/559 of query aligns to 429:563/573 of 3pl8A
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 10, 11, 12, 31, 32, 113, 115, 118, 119, 123, 124, 126, 238, 275, 279
- binding 3-deoxy-3-fluoro-beta-D-glucopyranose: 124, 403, 407, 411
3lsmA Pyranose 2-oxidase h167a mutant with flavin n(5) sulfite adduct (see paper)
27% identity, 24% coverage: 418:549/559 of query aligns to 430:564/574 of 3lsmA
- binding (s)-10-((2s,3s,4r)-5-((s)-((s)-(((2r,3s,4r,5r)-5-(6-amino-9h-purin-9-yl)-3,4-dihydroxy-tetrahydrofuran-2-yl)methoxy)(hydroxy)phosphoryloxy)(hydroxy)phosphoryloxy)-2,3,4-trihydroxypentyl)-7,8-dimethyl-2,4-dioxo-2,3,4,4a-tetrahydrobenzo[g]pteridine-5(10h)-sulfonic acid: H504 (= H491), N549 (= N534), T551 (≠ S536)
- binding sulfite ion: R527 (≠ Q512), G530 (≠ D515), K532 (= K517)
Sites not aligning to the query:
- binding alpha-D-glucopyranose: 19, 20, 157, 161, 566
- binding (s)-10-((2s,3s,4r)-5-((s)-((s)-(((2r,3s,4r,5r)-5-(6-amino-9h-purin-9-yl)-3,4-dihydroxy-tetrahydrofuran-2-yl)methoxy)(hydroxy)phosphoryloxy)(hydroxy)phosphoryloxy)-2,3,4-trihydroxypentyl)-7,8-dimethyl-2,4-dioxo-2,3,4,4a-tetrahydrobenzo[g]pteridine-5(10h)-sulfonic acid: 11, 12, 13, 32, 33, 114, 119, 120, 124, 125, 126, 127, 239, 276, 280, 428
- binding sulfite ion: 249
2f5vA Reaction geometry and thermostability mutant of pyranose 2-oxidase from the white-rot fungus peniophora sp. (see paper)
27% identity, 24% coverage: 418:549/559 of query aligns to 432:566/577 of 2f5vA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 11, 13, 14, 15, 34, 35, 116, 121, 122, 125, 126, 127, 129, 241, 278, 282
- binding beta-D-arabino-hexopyranos-2-ulose: 127, 406, 410, 430
1tt0A Crystal structure of pyranose 2-oxidase (see paper)
27% identity, 24% coverage: 418:549/559 of query aligns to 432:566/577 of 1tt0A
Sites not aligning to the query:
- binding acetate ion: 412
- binding flavin-adenine dinucleotide: 10, 13, 14, 15, 34, 35, 116, 117, 118, 121, 122, 125, 126, 127, 129, 241, 278, 282
2igoA Crystal structure of pyranose 2-oxidase h167a mutant with 2-fluoro-2- deoxy-d-glucose (see paper)
27% identity, 24% coverage: 418:549/559 of query aligns to 432:566/577 of 2igoA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 13, 14, 15, 34, 35, 116, 117, 118, 121, 122, 126, 127, 129, 241, 278
- binding 2-deoxy-2-fluoro-beta-D-glucopyranose: 127, 406
Query Sequence
>Echvi_1847 FitnessBrowser__Cola:Echvi_1847
MANQEYDAIVVGSGISGGWAAKELTEKGLKVLLLERGQNVEHVKDYKNATLPPWEIPHRG
RRTTEMVENHPNLKRDYVLNELVLDWWAHEDTSPYVEEKPFTWFRGYQVGGRSLLWGRQS
YRWSDLDFEANLKEGIAVDWPIRYKDIAPWYDYVEKFAGIAGNRDGLDVLPDGEFMPPFA
MNCVEKDVKERIAKHFEGKRHLINSRVANITEPLPGRPGCQARNKCWLGCPFGGYFSTQA
STLPAAMATGNLTLRPYSIVHRVLYDKDTKKATGVEIVDAETMETIEYKSKIVFLCASAL
NSAHVLMRSATDIWPEGLGSSSGELGHNVMDHHFRLGASGTVEGYDDKYYFGRRPGGIYI
PRYRNVGDDKRDYVRGFGYQGGASRSGWGRDVAEMNIGGPMKEALTEPGPWSMGMMAFGE
ILPYHENTIKISKDVKDKWGMYALVMNAEIKDNEQKMRKDMMNDAAEMLEAAGVKNIHTY
DSGYTFGQGIHEMGTARMGRDPKTSVLNENNQVWDAKNVFVTDGAAMTSAAAVNPSLTYM
ALTARAADFAVKELKKGNL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory