SitesBLAST
Comparing Echvi_1862 FitnessBrowser__Cola:Echvi_1862 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
39% identity, 96% coverage: 5:241/246 of query aligns to 7:240/244 of 6t77A
- active site: G16 (= G14), S138 (= S136), Y151 (= Y149)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G10), S14 (≠ A12), R15 (≠ S13), T37 (≠ R35), L58 (≠ F56), N59 (≠ D57), V60 (≠ L58), A87 (= A85), G88 (= G86), I89 (= I87)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
38% identity, 98% coverage: 1:241/246 of query aligns to 5:241/244 of 4nbuB
- active site: G18 (= G14), N111 (= N108), S139 (= S136), Q149 (≠ V146), Y152 (= Y149), K156 (= K153)
- binding acetoacetyl-coenzyme a: D93 (≠ K90), K98 (≠ E95), S139 (= S136), N146 (≠ I143), V147 (≠ P144), Q149 (≠ V146), Y152 (= Y149), F184 (= F181), M189 (= M186), K200 (= K200)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G10), N17 (≠ S13), G18 (= G14), I19 (≠ L15), D38 (≠ G34), F39 (≠ R35), V59 (≠ F56), D60 (= D57), V61 (≠ L58), N87 (= N84), A88 (= A85), G89 (= G86), I90 (= I87), T137 (≠ I134), S139 (= S136), Y152 (= Y149), K156 (= K153), P182 (= P179), F184 (= F181), T185 (≠ I182), T187 (= T184), M189 (= M186)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
38% identity, 96% coverage: 5:241/246 of query aligns to 10:243/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G10), S17 (≠ A12), R18 (≠ S13), I20 (≠ L15), T40 (≠ R35), N62 (≠ D57), V63 (≠ L58), N89 (= N84), A90 (= A85), I92 (= I87), V139 (≠ I134), S141 (= S136), Y154 (= Y149), K158 (= K153), P184 (= P179), G185 (= G180), I187 (= I182), T189 (= T184), M191 (= M186)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
35% identity, 96% coverage: 5:241/246 of query aligns to 8:248/252 of 1vl8B
- active site: G17 (= G14), S143 (= S136), I154 (≠ V146), Y157 (= Y149), K161 (= K153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G10), R16 (≠ S13), G17 (= G14), L18 (= L15), S37 (≠ G34), R38 (= R35), C63 (≠ F56), D64 (= D57), V65 (≠ L58), A91 (≠ N84), A92 (= A85), G93 (= G86), I94 (= I87), V114 (≠ T107), I141 (= I134), S143 (= S136), Y157 (= Y149), K161 (= K153), P187 (= P179), G188 (= G180), Y190 (≠ I182), T192 (= T184), M194 (= M186), T195 (≠ S187)
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
38% identity, 96% coverage: 5:241/246 of query aligns to 6:239/243 of 1q7bA
- active site: G15 (= G14), E101 (= E100), S137 (= S136), Q147 (≠ V146), Y150 (= Y149), K154 (= K153)
- binding calcium ion: E232 (≠ T234), T233 (≠ I235)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G10), S13 (≠ A12), R14 (≠ S13), T36 (≠ R35), N58 (≠ D57), V59 (≠ L58), N85 (= N84), A86 (= A85), G87 (= G86), I88 (= I87), S137 (= S136), Y150 (= Y149), K154 (= K153), P180 (= P179), G181 (= G180), I183 (= I182)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
38% identity, 96% coverage: 5:241/246 of query aligns to 7:240/244 of P0AEK2
- GASR 12:15 (≠ GGAS 10:13) binding
- T37 (≠ R35) binding
- NV 59:60 (≠ DL 57:58) binding
- N86 (= N84) binding
- Y151 (= Y149) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YTASK 149:153) binding
- A154 (≠ S152) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K153) mutation to A: Defect in the affinity for NADPH.
- I184 (= I182) binding
- E233 (≠ T234) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
38% identity, 96% coverage: 5:241/246 of query aligns to 6:239/243 of 1q7cA
- active site: G15 (= G14), S137 (= S136), Q147 (≠ V146), F150 (≠ Y149), K154 (= K153)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G10), S13 (≠ A12), R14 (≠ S13), A35 (≠ G34), T36 (≠ R35), L57 (≠ F56), N58 (≠ D57), V59 (≠ L58), G87 (= G86), I88 (= I87)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
37% identity, 96% coverage: 5:241/246 of query aligns to 10:239/243 of 4i08A
- active site: G19 (= G14), N113 (= N108), S141 (= S136), Q151 (≠ V146), Y154 (= Y149), K158 (= K153)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G10), S17 (≠ A12), R18 (≠ S13), I20 (≠ L15), T40 (≠ R35), N62 (≠ D57), V63 (≠ L58), N89 (= N84), A90 (= A85), G140 (≠ S135), S141 (= S136), Y154 (= Y149), K158 (= K153), P184 (= P179), G185 (= G180), T189 (= T184)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
38% identity, 96% coverage: 5:241/246 of query aligns to 7:240/244 of P0A2C9
- M125 (= M123) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A224) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S225) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
4qecA Elxo with NADP bound (see paper)
35% identity, 97% coverage: 3:241/246 of query aligns to 2:244/248 of 4qecA
- active site: G13 (= G14), N111 (= N108), S139 (= S136), Y152 (= Y149), K156 (= K153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ S13), G13 (= G14), I14 (≠ L15), S33 (≠ G34), R34 (= R35), K38 (≠ N36), D59 (= D57), V60 (≠ L58), N86 (= N84), A87 (= A85), G88 (= G86), I137 (= I134), Y152 (= Y149), K156 (= K153), P182 (= P179), I185 (= I182)
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
35% identity, 97% coverage: 3:241/246 of query aligns to 5:240/244 of 6t62A
- active site: G16 (= G14), S138 (= S136), Y151 (= Y149)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G10), S14 (≠ A12), R15 (≠ S13), A36 (≠ G34), T37 (≠ R35), L58 (≠ F56), D59 (= D57), V60 (≠ L58), N86 (= N84), A87 (= A85), G88 (= G86), I89 (= I87), I136 (= I134), S137 (= S135), S138 (= S136), Y151 (= Y149), K155 (= K153), P181 (= P179), G182 (= G180), I184 (= I182), M188 (= M186)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
35% identity, 97% coverage: 3:241/246 of query aligns to 5:240/244 of 6wprA
- active site: G16 (= G14), S138 (= S136), Y151 (= Y149)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G10), S14 (≠ A12), R15 (≠ S13), T37 (≠ R35), L58 (≠ F56), D59 (= D57), V60 (≠ L58), N86 (= N84), A87 (= A85), G88 (= G86), I89 (= I87), I136 (= I134), Y151 (= Y149), K155 (= K153), P181 (= P179)
4nbwA Crystal structure of fabg from plesiocystis pacifica (see paper)
36% identity, 99% coverage: 3:245/246 of query aligns to 1:252/253 of 4nbwA
- active site: G12 (= G14), S146 (= S136), Y159 (= Y149), K163 (= K153)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), N11 (≠ S13), G12 (= G14), I13 (≠ L15), D32 (≠ I31), L33 (≠ I32), V57 (≠ F56), D58 (= D57), V59 (≠ L58), N85 (= N84), A86 (= A85), G87 (= G86), S146 (= S136), Y159 (= Y149), K163 (= K153), I192 (= I182), T194 (= T184)
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
36% identity, 96% coverage: 6:241/246 of query aligns to 10:245/249 of 3uf0A
- active site: G18 (= G14), S141 (= S136), V151 (= V146), Y154 (= Y149), K158 (= K153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G10), S17 (= S13), G18 (= G14), I19 (≠ L15), R39 (= R35), D63 (= D57), L64 (= L58), N89 (= N84), G91 (= G86), I92 (= I87), I139 (= I134), A140 (≠ S135), S141 (= S136), Y154 (= Y149), K158 (= K153), P184 (= P179), G185 (= G180), V187 (≠ I182), T189 (= T184), N191 (≠ M186), T192 (≠ S187)
3lqfA Crystal structure of the short-chain dehydrogenase galactitol- dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD and erythritol (see paper)
37% identity, 98% coverage: 1:241/246 of query aligns to 9:250/254 of 3lqfA
- active site: G22 (= G14), S144 (= S136), Y159 (= Y149), K163 (= K153)
- binding meso-erythritol: N151 (≠ G142), Y159 (= Y149), Y191 (≠ F181), T197 (≠ S187), M200 (≠ L191)
- binding nicotinamide-adenine-dinucleotide: G18 (= G10), S21 (= S13), G22 (= G14), I23 (≠ L15), D42 (≠ G34), R43 (= R35), D66 (= D57), V67 (≠ L58), S92 (≠ N84), L142 (≠ I134), S144 (= S136), K163 (= K153), P189 (= P179), V192 (≠ I182), T194 (= T184), M196 (= M186), T197 (≠ S187)
2wsbA Crystal structure of the short-chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD (see paper)
37% identity, 98% coverage: 1:241/246 of query aligns to 9:250/254 of 2wsbA
- active site: G22 (= G14), S144 (= S136), Y159 (= Y149), K163 (= K153)
- binding nicotinamide-adenine-dinucleotide: G18 (= G10), S21 (= S13), G22 (= G14), I23 (≠ L15), D42 (≠ G34), R43 (= R35), D66 (= D57), V67 (≠ L58), S92 (≠ N84), A93 (= A85), L142 (≠ I134), S144 (= S136), Y159 (= Y149), K163 (= K153), P189 (= P179), V192 (≠ I182), T194 (= T184), M196 (= M186), T197 (≠ S187)
- binding n-propanol: S144 (= S136), M145 (= M137), N151 (≠ G142), N151 (≠ G142), Y159 (= Y149), Y159 (= Y149), Y191 (≠ F181)
2wdzA Crystal structure of the short chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD+ and 1,2-pentandiol (see paper)
37% identity, 98% coverage: 1:241/246 of query aligns to 9:250/254 of 2wdzA
- active site: G22 (= G14), S144 (= S136), Y159 (= Y149), K163 (= K153)
- binding (2S)-pentane-1,2-diol: A45 (≠ E37), D49 (≠ A41), R62 (≠ Y53), S146 (≠ A138), Y159 (= Y149)
- binding nicotinamide-adenine-dinucleotide: G18 (= G10), S21 (= S13), G22 (= G14), I23 (≠ L15), D42 (≠ G34), R43 (= R35), A65 (≠ F56), D66 (= D57), V67 (≠ L58), S92 (≠ N84), A93 (= A85), L142 (≠ I134), S144 (= S136), Y159 (= Y149), K163 (= K153), P189 (= P179), V192 (≠ I182), T194 (= T184), M196 (= M186), T197 (≠ S187)
C0KTJ6 Galactitol 2-dehydrogenase (L-tagatose-forming); Galactitol dehydrogenase; GDH; GatDH; Galactitol:NAD(+) 5-oxidoreductase; EC 1.1.1.406 from Cereibacter sphaeroides (Rhodobacter sphaeroides) (see paper)
37% identity, 98% coverage: 1:241/246 of query aligns to 9:250/254 of C0KTJ6
Sites not aligning to the query:
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
37% identity, 96% coverage: 5:241/246 of query aligns to 6:239/243 of 7emgB
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
36% identity, 96% coverage: 6:242/246 of query aligns to 9:238/241 of 5t2uA
- active site: G17 (= G14), T135 (≠ S136), T145 (≠ V146), Y148 (= Y149), K152 (= K153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G10), G17 (= G14), R38 (= R35), D39 (≠ N36), R42 (≠ K39), D60 (= D57), L61 (= L58), N83 (= N84), A84 (= A85), Y87 (≠ N88), I133 (= I134), T135 (≠ S136), Y148 (= Y149), K152 (= K153), P178 (= P179), P180 (≠ F181), T181 (≠ I182), T183 (= T184), T185 (≠ M186), T186 (≠ S187)
Query Sequence
>Echvi_1862 FitnessBrowser__Cola:Echvi_1862
MNKAIALVTGGASGLGLATAKKFCDHDITTIIIGRNESKLAKAQEELGPNCHYYAFDLND
LPNIPDLINTITTEHGKIDILVNNAGINMKKPFIEVTDEEFQQIITTNVFAVFSLSREIA
KTMASQKHGAIVNISSMASQYGIPKVIAYTASKSAIEGMTKAMAVELSPLGIRVNCVAPG
FIATEMSAKALNGDPERKQKVLSRTPMGALGTPANIADAVYYLASESASYITGTILPVDG
GNAIGF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory