Comparing Echvi_1879 FitnessBrowser__Cola:Echvi_1879 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
7cyyC Crystal structure of arabinose isomerase from hybrid ai8 with adonitol
59% identity, 99% coverage: 1:495/500 of query aligns to 2:494/497 of 7cyyC
4r1qE Crystal structure of thermophilic geobacillus kaustophilus l-arabinose isomerase in complex with l-arabitol
59% identity, 99% coverage: 1:496/500 of query aligns to 1:494/496 of 4r1qE
Q9S467 L-arabinose isomerase; EC 5.3.1.4 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
59% identity, 99% coverage: 1:496/500 of query aligns to 1:494/496 of Q9S467
4f2dA Crystal structure of escherichia coli l-arabinose isomerase (ecai) complexed with ribitol
57% identity, 98% coverage: 8:497/500 of query aligns to 8:498/498 of 4f2dA
7chlA Crystal structure of hybrid arabinose isomerase ai-10
57% identity, 98% coverage: 8:495/500 of query aligns to 7:495/498 of 7chlA
7ch3B Crystal structure of arabinose isomerase from hyper thermophilic bacterium thermotoga maritima (tmai) triple mutant (k264a, e265a, k266a)
54% identity, 99% coverage: 1:495/500 of query aligns to 1:491/495 of 7ch3B
7ch3A Crystal structure of arabinose isomerase from hyper thermophilic bacterium thermotoga maritima (tmai) triple mutant (k264a, e265a, k266a)
53% identity, 99% coverage: 1:495/500 of query aligns to 1:465/469 of 7ch3A
>Echvi_1879 FitnessBrowser__Cola:Echvi_1879
MKNLKENEVWFITGSQHLYGPEALQQVAEHAQIIAEELNKSEKISVTTVFKPIVTTTEEI
YAAIQEANNAPNCIGVITWMHTFSPAKMWINGLKILQKPMLHLHTQYNQDIPWNSIDMDF
MNLNQSAHGDREFGFMTARMKVKRKVVVGHWKDEEVHSQIDVWARAASGWHDWQGAKFAR
FGDNMRFVAVTDGDKVEAELKFGFSVNTYAVGDLVAKIEAVSEGDLKALIEEYEATYTLS
EELQANGAKRQSLIDAAKIELGMRAFLEEGGFKGFSNTFEDLYGMKQLPGIATQRLMADG
YAYAGEGDWKTAALVRAMKVMGSGLEGGNAFMEDYTYHFDPNNSLVLGSHMLEVDPTLTT
EKISCEVHPLGIGGKEDPVRLVFNGAGGNGLNASIVDMGNRFRLIVNDVEAVKPLKDLPN
LPVARVMWKPMPDMKTGCAAWILAGGAHHTCFSQNLTSEHLNDFAVMAGIESVNIDKETT
LRGIQNELRWSDAYYHFNDK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory