Comparing Echvi_2002 FitnessBrowser__Cola:Echvi_2002 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
1vb3A Crystal structure of threonine synthase from escherichia coli
46% identity, 95% coverage: 1:407/430 of query aligns to 1:405/428 of 1vb3A
4f4fA X-ray crystal structure of plp bound threonine synthase from brucella melitensis
36% identity, 99% coverage: 1:427/430 of query aligns to 2:459/464 of 4f4fA
8g1yA Crystal structure of the threonine synthase from streptococcus pneumoniae in complex with pyridoxal 5-phosphate.
37% identity, 90% coverage: 3:391/430 of query aligns to 7:440/496 of 8g1yA
1kl7A Crystal structure of threonine synthase from yeast (see paper)
35% identity, 90% coverage: 13:400/430 of query aligns to 18:475/509 of 1kl7A
Q42598 Threonine synthase; TS; EC 4.2.3.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
35% identity, 90% coverage: 1:388/430 of query aligns to 5:459/514 of Q42598
A0R220 Threonine synthase; TS; EC 4.2.3.1 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
25% identity, 62% coverage: 102:367/430 of query aligns to 64:312/360 of A0R220
P9WG59 Threonine synthase; TS; EC 4.2.3.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
25% identity, 60% coverage: 102:361/430 of query aligns to 64:306/360 of P9WG59
Sites not aligning to the query:
2d1fA Structure of mycobacterium tuberculosis threonine synthase (see paper)
25% identity, 60% coverage: 102:361/430 of query aligns to 55:297/349 of 2d1fA
Sites not aligning to the query:
6nmxA Threonine synthase from bacillus subtilis atcc 6633 with plp and appa (see paper)
29% identity, 36% coverage: 102:254/430 of query aligns to 55:193/350 of 6nmxA
Sites not aligning to the query:
6cgqB Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
29% identity, 36% coverage: 102:254/430 of query aligns to 53:191/345 of 6cgqB
Sites not aligning to the query:
>Echvi_2002 FitnessBrowser__Cola:Echvi_2002
MKFYSTNNKEHKVSLKEAVIKGLAPDQGLYMPERIPTLPADFIDQLPERSFQEIGYEVIG
AIFGEDLSKEQIKELVDHTLAFDAPLVKVEEEVYTLELFHGPTLAFKDFGARFCSKLMSL
LVKDEKVRVLVATSGDTGSAVANGFYKVPGVEVIILYPSGKVSTLQEKQFTTLGENITAL
EVDGVFDDCQRMVKQAFLDKDLNESMLLTSANSINIARWIPQCLYYFYAYSRLPKGHEKV
VFSVPSGNFGNIAAGMLAERMGLPIETFVAATNVNKIVPDFLKGVPFRPRPSLQTISNSM
DVGNPSNFYRLLDLYGDESKLKEMVKGFFFDDATTREAMATVKAAAGYLMDPHGAVAYLG
LKAYMEEHPGYTGVFLETAHPGKFGDVVEAVHQEKVTLPERLAAFLDGQKKTKLMANDYQ
EFKTYLRSKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory