SitesBLAST
Comparing Echvi_2058 FitnessBrowser__Cola:Echvi_2058 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P78827 Probable ketol-acid reductoisomerase, mitochondrial; Acetohydroxy-acid reductoisomerase; Alpha-keto-beta-hydroxylacyl reductoisomerase; EC 1.1.1.86 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
57% identity, 99% coverage: 3:347/347 of query aligns to 58:402/404 of P78827
- S261 (= S206) modified: Phosphoserine
7tocA Crystal structure of the mitochondrial ketol-acid reductoisomerase ilvc from candida auris
60% identity, 99% coverage: 3:346/347 of query aligns to 15:358/359 of 7tocA
- binding magnesium ion: K161 (= K149), D219 (= D207), D219 (= D207), E223 (= E211)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G48 (= G36), G50 (= G38), S51 (≠ V39), Q52 (= Q40), R72 (= R60), S77 (≠ T65), L108 (= L96), L109 (= L97), S110 (= S98), D111 (= D99), A113 (≠ G101), E116 (≠ A104), H135 (= H123), G162 (= G150), S163 (= S151), S281 (= S269), T282 (= T270), Y328 (= Y316), R329 (= R317)
7q03A Ketol-acid reductoisomerase from methanothermococcus thermolithotrophicus in the close state with NADP and mg2+ (see paper)
35% identity, 92% coverage: 25:342/347 of query aligns to 12:323/328 of 7q03A
- binding magnesium ion: D190 (= D207), E194 (= E211)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y37), G25 (= G38), S26 (≠ V39), Q27 (= Q40), R47 (= R60), S52 (≠ T65), L79 (= L96), I80 (≠ L97), P81 (≠ S98), D82 (= D99), I84 (≠ G101), H107 (= H123), P132 (≠ S151)
Q65XK0 Ketol-acid reductoisomerase, chloroplastic; Acetohydroxy-acid reductoisomerase; Alpha-keto-beta-hydroxylacyl reductoisomerase; Protein KARI; EC 1.1.1.86 from Oryza sativa subsp. japonica (Rice) (see paper)
32% identity, 100% coverage: 2:347/347 of query aligns to 79:438/578 of Q65XK0
- 111:118 (vs. 33:40, 50% identical) binding
- RKGSKS 144:149 (≠ RKNSKT 60:65) binding
- SDAAQ 183:187 (≠ SDAGQ 98:102) binding
3fr8B Rice ketolacid reductoisomerase in complex with mg2+-NADPH (see paper)
32% identity, 100% coverage: 2:347/347 of query aligns to 21:380/517 of 3fr8B
- active site: K176 (= K149), D239 (= D207), E243 (= E211)
- binding magnesium ion: H150 (= H123), D239 (= D207), E243 (= E211)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: W57 (≠ Y37), S59 (≠ V39), Q60 (= Q40), R86 (= R60), S89 (= S63), L123 (= L96), I124 (≠ L97), S125 (= S98), D126 (= D99), A128 (≠ G101), S149 (= S122), H150 (= H123), M178 (≠ S151), G179 (= G152)
Sites not aligning to the query:
5e4rA Crystal structure of domain-duplicated synthetic class ii ketol-acid reductoisomerase 2ia_kari-dd (see paper)
35% identity, 92% coverage: 25:343/347 of query aligns to 12:321/466 of 5e4rA
- active site: K130 (= K149), D190 (= D207), E194 (= E211)
- binding oxo(propan-2-ylamino)acetic acid: P132 (≠ S151), D190 (= D207), E194 (= E211)
- binding magnesium ion: D190 (= D207), E194 (= E211)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G25 (= G38), S26 (≠ V39), Q27 (= Q40), S52 (≠ T65), L79 (= L96), V80 (≠ L97), P81 (≠ S98), D82 (= D99), V84 (≠ G101), A106 (≠ S122), H107 (= H123), P132 (≠ S151)
Sites not aligning to the query:
4xdzA Holo structure of ketol-acid reductoisomerase from ignisphaera aggregans (see paper)
35% identity, 92% coverage: 25:343/347 of query aligns to 12:321/328 of 4xdzA
- active site: K130 (= K149), D190 (= D207), E194 (= E211)
- binding oxo(propan-2-ylamino)acetic acid: P132 (≠ S151), D190 (= D207), E194 (= E211), L198 (= L215), E230 (= E247), V250 (≠ C268), S251 (= S269), A254 (= A272)
- binding magnesium ion: D190 (= D207), E194 (= E211)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G23 (= G36), G25 (= G38), S26 (≠ V39), Q27 (= Q40), E47 (≠ R60), R48 (≠ K61), S52 (≠ T65), L79 (= L96), V80 (≠ L97), P81 (≠ S98), D82 (= D99), V84 (≠ G101), A106 (≠ S122), H107 (= H123), P132 (≠ S151)
E0SRA9 Ketol-acid reductoisomerase (NAD(P)(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.383 from Ignisphaera aggregans (strain DSM 17230 / JCM 13409 / AQ1.S1) (see paper)
35% identity, 92% coverage: 25:343/347 of query aligns to 13:322/335 of E0SRA9
Q64BR7 Ketol-acid reductoisomerase (NAD(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.382 from Uncultured archaeon GZfos26G2 (see paper)
35% identity, 91% coverage: 26:342/347 of query aligns to 13:328/332 of Q64BR7
4xdyA Structure of nadh-preferring ketol-acid reductoisomerase from an uncultured archean (see paper)
35% identity, 91% coverage: 26:342/347 of query aligns to 13:328/331 of 4xdyA
- active site: K135 (= K149), D195 (= D207), E199 (= E211)
- binding n-hydroxy-n-isopropyloxamic acid: P137 (≠ S151), D195 (= D207), E199 (= E211), E235 (= E247), I239 (≠ L252), I255 (≠ C268), S256 (= S269), A259 (= A272)
- binding magnesium ion: D195 (= D207), E199 (= E211)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G25 (= G38), A26 (≠ V39), Q27 (= Q40), E46 (≠ Q59), L50 (vs. gap), N55 (≠ S63), S57 (≠ T65), L84 (= L96), L85 (= L97), P86 (≠ S98), D87 (= D99), I93 (≠ L105), H112 (= H123), P137 (≠ S151)
C8WR67 Ketol-acid reductoisomerase (NADP(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.86 from Alicyclobacillus acidocaldarius subsp. acidocaldarius (strain ATCC 27009 / DSM 446 / BCRC 14685 / JCM 5260 / KCTC 1825 / NBRC 15652 / NCIMB 11725 / NRRL B-14509 / 104-IA) (Bacillus acidocaldarius) (see paper)
37% identity, 79% coverage: 27:299/347 of query aligns to 15:275/344 of C8WR67
- YGSQ 25:28 (≠ YGVQ 37:40) binding
- R48 (= R60) binding ; mutation to P: Inversion of the cofactor specificity from NADPH to NADH.
- S52 (≠ T65) binding ; mutation to D: Inversion of the cofactor specificity from NADPH to NADH.
- DERQ 82:85 (≠ DAGQ 99:102) binding
- G133 (= G152) binding
- D190 (= D207) binding
- E194 (= E211) binding
- E226 (= E243) binding
4tskA Ketol-acid reductoisomerase from alicyclobacillus acidocaldarius (see paper)
37% identity, 79% coverage: 27:299/347 of query aligns to 14:274/333 of 4tskA
- active site: K129 (= K149), D189 (= D207), E193 (= E211)
- binding magnesium ion: D189 (= D207), D189 (= D207), E193 (= E211), E193 (= E211), R246 (≠ Y265), Y247 (≠ A266), I249 (≠ C268), D251 (≠ T270), Q254 (= Q273)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y37), G25 (= G38), S26 (≠ V39), Q27 (= Q40), L46 (≠ Q59), R47 (= R60), S51 (≠ T65), L78 (= L96), L79 (= L97), P80 (≠ S98), D81 (= D99), H106 (= H123), P131 (≠ S151)
1yveI Acetohydroxy acid isomeroreductase complexed with NADPH, magnesium and inhibitor ipoha (n-hydroxy-n-isopropyloxamate) (see paper)
32% identity, 91% coverage: 32:347/347 of query aligns to 46:374/513 of 1yveI
- active site: K170 (= K149), D233 (= D207), E237 (= E211)
- binding n-hydroxy-n-isopropyloxamic acid: M172 (≠ S151), D233 (= D207), E237 (= E211)
- binding magnesium ion: D233 (= D207), E237 (= E211)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G50 (= G36), W51 (≠ Y37), S53 (≠ V39), Q54 (= Q40), R80 (= R60), S83 (= S63), S85 (≠ T65), M104 (≠ L83), L117 (= L96), I118 (≠ L97), S119 (= S98), D120 (= D99), A122 (≠ G101), H144 (= H123), M172 (≠ S151)
Sites not aligning to the query:
1qmgA Acetohydroxyacid isomeroreductase complexed with its reaction product dihydroxy-methylvalerate, manganese and adp-ribose. (see paper)
32% identity, 91% coverage: 32:347/347 of query aligns to 47:375/514 of 1qmgA
- active site: K171 (= K149), D234 (= D207), E238 (= E211)
- binding 2'-monophosphoadenosine-5'-diphosphoribose: G51 (= G36), W52 (≠ Y37), G53 (= G38), S54 (≠ V39), Q55 (= Q40), R81 (= R60), S84 (= S63), S86 (≠ T65), L118 (= L96), I119 (≠ L97), S120 (= S98), D121 (= D99), A123 (≠ G101), H145 (= H123)
- binding 2,3-dihydroxy-valerianic acid: M173 (≠ S151), D234 (= D207), E238 (= E211)
- binding manganese (ii) ion: D234 (= D207), E238 (= E211)
Sites not aligning to the query:
Q01292 Ketol-acid reductoisomerase, chloroplastic; Acetohydroxy-acid reductoisomerase; Alpha-keto-beta-hydroxylacyl reductoisomerase; EC 1.1.1.86 from Spinacia oleracea (Spinach) (see 3 papers)
32% identity, 96% coverage: 15:347/347 of query aligns to 112:456/595 of Q01292
- 129:136 (vs. 33:40, 50% identical) binding
- RKGSNS 162:167 (≠ RKNSKT 60:65) binding
- SDSAQ 201:205 (≠ SDAGQ 98:102) binding
Sites not aligning to the query:
- 1:72 modified: transit peptide, Chloroplast
6vo2A Crystal structure of staphylococcus aureus ketol-acid reductoisomerase in complex with mg, NADPH and inhibitor. (see paper)
34% identity, 92% coverage: 25:344/347 of query aligns to 12:324/326 of 6vo2A
- binding magnesium ion: D189 (= D207), E193 (= E211)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y37), G25 (= G38), S26 (≠ V39), Q27 (= Q40), I46 (≠ Q59), R47 (= R60), S51 (≠ T65), L78 (= L96), L79 (= L97), P80 (≠ S98), D81 (= D99), H106 (= H123), P131 (≠ S151), I249 (≠ C268), S250 (= S269)
- binding 3-(methylsulfonyl)-2-oxopropanoic acid: G130 (= G150), P131 (≠ S151), D189 (= D207), E193 (= E211), E229 (= E247), I249 (≠ C268), S250 (= S269), A253 (= A272)
6c5nA Crystal structure of staphylococcus aureus ketol-acid reductoisomerase with hydroxyoxamate inhibitor 1
34% identity, 92% coverage: 25:344/347 of query aligns to 12:324/326 of 6c5nA
- active site: K129 (= K149), D189 (= D207), E193 (= E211)
- binding (cyclopentylamino)(oxo)acetic acid: P131 (≠ S151), D189 (= D207), E193 (= E211), C198 (≠ M216), E229 (= E247), I233 (≠ L252), I249 (≠ C268), S250 (= S269), A253 (= A272)
- binding [cyclopentyl(hydroxy)amino](oxo)acetic acid: P131 (≠ S151), D189 (= D207), E193 (= E211), C198 (≠ M216), E229 (= E247), I249 (≠ C268), S250 (= S269), A253 (= A272)
- binding magnesium ion: D189 (= D207), E193 (= E211)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y37), G25 (= G38), S26 (≠ V39), Q27 (= Q40), I46 (≠ Q59), R47 (= R60), S51 (≠ T65), L78 (= L96), L79 (= L97), P80 (≠ S98), D81 (= D99), H106 (= H123), P131 (≠ S151), S248 (≠ N267), I249 (≠ C268), S250 (= S269)
6c55A Crystal structure of staphylococcus aureus ketol-acid reductosimerrase with hydroxyoxamate inhibitor 3
34% identity, 92% coverage: 25:344/347 of query aligns to 12:324/326 of 6c55A
- active site: K129 (= K149), D189 (= D207), E193 (= E211)
- binding [cyclohexyl(hydroxy)amino](oxo)acetic acid: P131 (≠ S151), D189 (= D207), E193 (= E211), C198 (≠ M216)
- binding (cyclohexylamino)(oxo)acetic acid: P131 (≠ S151), D189 (= D207), E193 (= E211), C198 (≠ M216), I249 (≠ C268), S250 (= S269), A253 (= A272)
- binding magnesium ion: D189 (= D207), E193 (= E211)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G25 (= G38), S26 (≠ V39), Q27 (= Q40), I46 (≠ Q59), R47 (= R60), S51 (≠ T65), L79 (= L97), P80 (≠ S98), D81 (= D99), I83 (≠ G101), H106 (= H123), S248 (≠ N267), S250 (= S269)
6bulB Crystal structure of staphylococcus aureus ketol-acid reductoisomerase with hydroxyoxamate inhibitor 2
34% identity, 92% coverage: 25:344/347 of query aligns to 12:324/327 of 6bulB
- active site: K129 (= K149), D189 (= D207), E193 (= E211)
- binding {hydroxy[(1S)-1-phenylethyl]amino}(oxo)acetic acid: P131 (≠ S151), D189 (= D207), E193 (= E211), E229 (= E247), I233 (≠ L252), I249 (≠ C268), S250 (= S269), A253 (= A272)
- binding oxo{[(1S)-1-phenylethyl]amino}acetic acid: P131 (≠ S151), D189 (= D207), E193 (= E211), E229 (= E247), I233 (≠ L252), I249 (≠ C268), S250 (= S269), A253 (= A272)
- binding magnesium ion: D189 (= D207), E193 (= E211)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y37), G25 (= G38), S26 (≠ V39), Q27 (= Q40), I46 (≠ Q59), R47 (= R60), S51 (≠ T65), L78 (= L96), L79 (= L97), P80 (≠ S98), D81 (= D99), H106 (= H123), P131 (≠ S151), S248 (≠ N267), I249 (≠ C268), S250 (= S269)
6aqjA Crystal structures of staphylococcus aureus ketol-acid reductoisomerase in complex with two transition state analogs that have biocidal activity. (see paper)
34% identity, 92% coverage: 25:344/347 of query aligns to 12:324/326 of 6aqjA
- active site: K129 (= K149), D189 (= D207), E193 (= E211)
- binding oxo(propan-2-ylamino)acetic acid: P131 (≠ S151), D189 (= D207), E193 (= E211), E229 (= E247), I233 (≠ L252), I249 (≠ C268), S250 (= S269), A253 (= A272)
- binding n-hydroxy-n-isopropyloxamic acid: P131 (≠ S151), D189 (= D207), E193 (= E211), E229 (= E247), I249 (≠ C268), S250 (= S269), A253 (= A272)
- binding magnesium ion: D189 (= D207), E193 (= E211)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y37), G25 (= G38), S26 (≠ V39), Q27 (= Q40), I46 (≠ Q59), R47 (= R60), S51 (≠ T65), L78 (= L96), L79 (= L97), P80 (≠ S98), D81 (= D99), H106 (= H123), P131 (≠ S151), I249 (≠ C268), S250 (= S269)
Query Sequence
>Echvi_2058 FitnessBrowser__Cola:Echvi_2058
MKLKFGTVEEDVVTREEFPLEKAREVLKDEVIAVLGYGVQGPGQALNLKDNGFNVIVGQR
KNSKTWDKAVADGWVPGETLFELEEACEKGTILQFLLSDAGQIALWPTVKKHLTPGKALY
FSHGFGVTYKDQTGIVPPEDVDVILVAPKGSGTSLRRMFVEGRGLNSSFAIYQDATGKAR
ERVIALGIGVGSGYLFETDFYREVTSDLTGERGTLMGAIQGIFAAQYEVLRENGHSPSEA
FNETVEELTQSLMPLVAENGMDWMYANCSTTAQRGALDWWKPFRDASKPVFEQLYKSVKD
GKEAAKSIESNSKADYREKLEVELKELRESEMWKAGATVRKLRPENN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory