SitesBLAST
Comparing Echvi_2076 FitnessBrowser__Cola:Echvi_2076 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1guzA Structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases (see paper)
53% identity, 96% coverage: 3:301/312 of query aligns to 2:300/305 of 1guzA
- active site: D147 (= D149), R150 (= R152), H174 (= H176)
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), N10 (= N11), V11 (= V12), D32 (= D33), V33 (≠ I34), T76 (= T78), G78 (= G80), L79 (= L81), P80 (= P82), I97 (= I99), V117 (= V119), N119 (= N121), M142 (= M144), L146 (= L148), H174 (= H176), P228 (= P229)
7byaA Malate dehydrogenase from geobacillus stearothermophilus (gs-mdh) complexed with oxaloacetic acid (oaa) and adenosine 5'- diphosphoribose (apr) (see paper)
54% identity, 98% coverage: 3:307/312 of query aligns to 6:311/311 of 7byaA
7by9A Malate dehydrogenase from geobacillus stearothermophilus (gs-mdh) complexed with oxaloacetic acid (oaa) and nicotinamide adenine dinucleotide (NAD) (see paper)
54% identity, 98% coverage: 3:307/312 of query aligns to 6:311/311 of 7by9A
- binding nicotinamide-adenine-dinucleotide: G11 (= G8), G13 (= G10), F14 (≠ N11), T15 (≠ V12), D35 (= D33), I36 (= I34), T81 (= T78), A82 (≠ S79), I102 (= I99), Q105 (≠ S102), V106 (= V103), L122 (≠ V119), N124 (= N121), V126 (≠ L123)
- binding oxaloacetate ion: L151 (= L148), R155 (= R152), H179 (= H176), G217 (= G214)
P49814 Malate dehydrogenase; Vegetative protein 69; VEG69; EC 1.1.1.37 from Bacillus subtilis (strain 168) (see 2 papers)
52% identity, 97% coverage: 3:306/312 of query aligns to 7:311/312 of P49814
- S149 (≠ A145) modified: Phosphoserine
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P80039 Malate dehydrogenase; EC 1.1.1.37 from Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) (Chlorobium tepidum) (see paper)
51% identity, 98% coverage: 3:308/312 of query aligns to 2:307/310 of P80039
7f8dA Malate dehydrogenase from geobacillus stearothermophilus (gs-mdh) g218y mutant (see paper)
53% identity, 98% coverage: 3:307/312 of query aligns to 8:313/313 of 7f8dA
- binding nicotinamide-adenine-dinucleotide: G15 (= G10), F16 (≠ N11), T17 (≠ V12), D37 (= D33), I38 (= I34), L41 (vs. gap), Y71 (= Y66), T83 (= T78), A84 (≠ S79), G85 (= G80), L124 (≠ V119), T125 (≠ S120), N126 (= N121), Q149 (≠ M144), L153 (= L148), P235 (= P229)
1uxgA Large improvement in the thermal stability of a tetrameric malate dehydrogenase by single point mutations at the dimer-dimer interface. (see paper)
54% identity, 98% coverage: 3:309/312 of query aligns to 3:308/308 of 1uxgA
- active site: R87 (= R89), D147 (= D149), R150 (= R152), H174 (= H176)
- binding fumaric acid: R81 (= R83), R87 (= R89), L146 (= L148), R150 (= R152), H174 (= H176), G212 (= G214), S223 (= S224)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (≠ N11), V12 (= V12), D32 (= D33), T76 (= T78), S77 (= S79), G78 (= G80), A79 (≠ L81), P80 (= P82), C101 (≠ V103), V117 (= V119), N119 (= N121), Q142 (≠ M144), H174 (= H176), P228 (= P229)
P80040 Malate dehydrogenase; EC 1.1.1.37 from Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) (see 2 papers)
54% identity, 98% coverage: 3:309/312 of query aligns to 4:309/309 of P80040
1gv0A Structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases (see paper)
50% identity, 96% coverage: 3:301/312 of query aligns to 2:296/301 of 1gv0A
- active site: D143 (= D149), R146 (= R152), H170 (= H176)
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), N10 (= N11), V11 (= V12), D32 (= D33), V33 (≠ I34), T76 (= T78), A77 (≠ S79), G78 (= G80), L79 (= L81), P80 (= P82), V113 (= V119), N115 (= N121), M138 (= M144), P224 (= P229)
4rosA Crystal structure of methylobacterium extorquens malate dehydrogenase complexed with oxaloacetate and adenosine-5-diphosphoribose
47% identity, 100% coverage: 2:312/312 of query aligns to 3:317/318 of 4rosA
- active site: R88 (= R89), D148 (= D149), R151 (= R152), H175 (= H176)
- binding adenosine-5-diphosphoribose: G11 (= G10), Q12 (≠ N11), I13 (≠ V12), D33 (= D33), I34 (= I34), T77 (= T78), A78 (≠ S79), G79 (= G80), V80 (≠ L81), P81 (= P82), V98 (≠ I99), T119 (≠ S120), N120 (= N121)
- binding oxaloacetate ion: R82 (= R83), R88 (= R89), N120 (= N121), L147 (= L148), R151 (= R152), H175 (= H176), G218 (= G214)
4pltB Crystal structure of ancestral apicomplexan malate dehydrogenase with oxamate. (see paper)
49% identity, 96% coverage: 3:303/312 of query aligns to 5:314/319 of 4pltB
- active site: R94 (= R89), D154 (= D149), R157 (= R152), H181 (= H176)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G12 (= G10), N13 (= N11), I14 (≠ V12), F33 (≠ V32), D34 (= D33), I35 (= I34), T78 (= T78), A79 (≠ S79), G80 (= G80), I81 (≠ L81), P82 (= P82), I104 (= I99), V124 (= V119), N126 (= N121), M149 (= M144), H181 (= H176), P240 (= P229)
4plyA Crystal structure of ancestral apicomplexan malate dehydrogenase with malate. (see paper)
49% identity, 96% coverage: 3:303/312 of query aligns to 4:313/318 of 4plyA
- active site: D153 (= D149), R156 (= R152), H180 (= H176)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G10), N12 (= N11), I13 (≠ V12), D33 (= D33), I34 (= I34), Y65 (= Y66), T77 (= T78), A78 (≠ S79), G79 (= G80), I80 (≠ L81), P81 (= P82), I103 (= I99), V123 (= V119), N125 (= N121), M148 (= M144), L152 (= L148), H180 (= H176), P239 (= P229)
- binding pyruvic acid: W91 (≠ M87), R93 (= R89), N125 (= N121), R156 (= R152), H180 (= H176), G223 (= G214)
5ujkA Malate dehydrogenase from methylobacterium extorquens, complexed with NAD (see paper)
47% identity, 99% coverage: 2:309/312 of query aligns to 3:314/315 of 5ujkA
- active site: R88 (= R89), D148 (= D149), R151 (= R152), H175 (= H176)
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), Q12 (≠ N11), I13 (≠ V12), D33 (= D33), I34 (= I34), T77 (= T78), A78 (≠ S79), G79 (= G80), V98 (≠ I99), I118 (≠ V119), N120 (= N121), M143 (= M144), L147 (= L148), H175 (= H176)
3gvhA Crystal structure of lactate/malate dehydrogenase from brucella melitensis
46% identity, 94% coverage: 2:295/312 of query aligns to 3:300/318 of 3gvhA
- active site: R88 (= R89), D148 (= D149), R151 (= R152), H175 (= H176)
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), I13 (≠ V12), D33 (= D33), I34 (= I34), T77 (= T78), A78 (≠ S79), I118 (≠ V119), N120 (= N121), M143 (= M144), L147 (= L148), H175 (= H176)
3gviA Crystal structure of lactate/malate dehydrogenase from brucella melitensis in complex with adp
45% identity, 94% coverage: 2:295/312 of query aligns to 3:295/314 of 3gviA
4plfB Crystal structure of ancestral apicomplexan lactate dehydrogenase with lactate. (see paper)
44% identity, 99% coverage: 3:310/312 of query aligns to 6:322/330 of 4plfB
- active site: R95 (= R89), D155 (= D149), R158 (= R152), H182 (= H176)
- binding nicotinamide-adenine-dinucleotide: G13 (= G10), M14 (≠ N11), I15 (≠ V12), F34 (≠ V32), D35 (= D33), V36 (≠ I34), T79 (= T78), A80 (≠ S79), G81 (= G80), L82 (= L81), T83 (≠ P82), I105 (= I99), I125 (≠ V119), N127 (= N121), M150 (= M144), H182 (= H176), P241 (= P229)
- binding pyruvic acid: W93 (≠ M87), R95 (= R89), N127 (= N121), R158 (= R152), H182 (= H176)
4plcA Crystal structure of ancestral apicomplexan lactate dehydrogenase with malate. (see paper)
44% identity, 99% coverage: 3:310/312 of query aligns to 6:322/324 of 4plcA
- active site: R95 (= R89), D155 (= D149), R158 (= R152), H182 (= H176)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G13 (= G10), M14 (≠ N11), I15 (≠ V12), D35 (= D33), V36 (≠ I34), T79 (= T78), A80 (≠ S79), G81 (= G80), L82 (= L81), T83 (≠ P82), I125 (≠ V119), N127 (= N121), M150 (= M144), H182 (= H176), P241 (= P229)
- binding pyruvic acid: W93 (≠ M87), R95 (= R89), N127 (= N121), R158 (= R152), H182 (= H176), G225 (= G214)
6vdjA Crystal structure of ancestral apicomplexan lactate dehydrogenase with sulfate and nadh4.
45% identity, 98% coverage: 3:309/312 of query aligns to 4:307/308 of 6vdjA
- binding 1,4,5,6-tetrahydronicotinamide adenine dinucleotide: G11 (= G10), M12 (≠ N11), I13 (≠ V12), D33 (= D33), V34 (≠ I34), A78 (≠ S79), I91 (= I99), I111 (≠ V119), T112 (≠ S120), N113 (= N121), M136 (= M144), H168 (= H176)
1sowA T. Gondii bradyzoite-specific ldh (ldh2) in complex with NAD and oxalate
44% identity, 99% coverage: 3:311/312 of query aligns to 7:321/322 of 1sowA
- active site: R96 (= R89), D156 (= D149), R159 (= R152), H183 (= H176)
- binding nicotinamide-adenine-dinucleotide: G14 (= G10), M15 (≠ N11), I16 (≠ V12), D36 (= D33), V37 (≠ I34), T80 (= T78), A81 (≠ S79), G82 (= G80), L83 (= L81), T84 (≠ P82), I106 (= I99), E109 (≠ S102), V126 (= V119), T127 (≠ S120), N128 (= N121), M151 (= M144), L155 (= L148), H183 (= H176), P242 (= P229)
- binding oxalate ion: W94 (≠ M87), R96 (= R89), R159 (= R152), H183 (= H176), G226 (= G214)
3czmB T. Gondii bradyzoite-specific ldh (ldh2) in complex with NAD and oxq
44% identity, 99% coverage: 3:311/312 of query aligns to 8:322/323 of 3czmB
- active site: R97 (= R89), D157 (= D149), R160 (= R152), H184 (= H176)
- binding nicotinamide-adenine-dinucleotide: G15 (= G10), M16 (≠ N11), I17 (≠ V12), D37 (= D33), V38 (≠ I34), T81 (= T78), A82 (≠ S79), G83 (= G80), L84 (= L81), T85 (≠ P82), I107 (= I99), V127 (= V119), N129 (= N121), M152 (= M144), H184 (= H176)
- binding 4-hydroxy-1,2,5-oxadiazole-3-carboxylic acid: W95 (≠ M87), R97 (= R89), N129 (= N121), R160 (= R152), H184 (= H176), G227 (= G214), S238 (= S224)
Query Sequence
>Echvi_2076 FitnessBrowser__Cola:Echvi_2076
MTKVTVVGAGNVGATCADVLAYREIAEEIVLVDIKEGVAEGKALDIWQKAPINAYDSRTV
GSTNDYTKTAGSDVVVITSGLPRKPGMTRDDLIETNAGIVKSVTENVVKHSPDAIIIIVS
NPLDVMTYQAHITSKMPRTKVMGMAGILDTARYRAFLAEALDVSPKEIQAILMGGHGDTM
VPLPRYTTVAGIPVTELIEKDKLDAIIERTKFGGGELVKLMGTSAWYAPGSAAAQMVEAI
LKNQRRVFPVCVKLDGEYGIDDCYLGVPVILGKNGIEKVIELDLNEDEKALLETSRKHVK
EVMAVLDSVGSK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory