SitesBLAST
Comparing Echvi_2202 FitnessBrowser__Cola:Echvi_2202 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ht5A Crystal structure of ilve a branched chain amino acid transaminase from mycobacterium tuberculosis (see paper)
41% identity, 91% coverage: 32:355/355 of query aligns to 3:334/335 of 3ht5A
- active site: K171 (= K195)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R68 (= R96), K171 (= K195), Y176 (= Y200), E207 (= E231), G210 (≠ T234), M211 (= M235), N212 (= N236), L235 (= L256), G237 (= G258), I238 (= I259), T239 (= T260), T281 (= T302)
5u3fA Structure of mycobacterium tuberculosis ilve, a branched-chain amino acid transaminase, in complex with d-cycloserine derivative (see paper)
41% identity, 91% coverage: 32:355/355 of query aligns to 2:325/326 of 5u3fA
- active site: K162 (= K195)
- binding (5-hydroxy-6-methyl-4-{[(3-oxo-2,3-dihydro-1,2-oxazol-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate: G45 (= G74), R67 (= R96), Y110 (= Y138), K162 (= K195), Y167 (= Y200), E198 (= E231), G201 (≠ T234), M202 (= M235), N203 (= N236), L226 (= L256), G228 (= G258), I229 (= I259), T230 (= T260), T272 (= T302)
3dtgA Structural analysis of mycobacterial branched chain aminotransferase- implications for inhibitor design
41% identity, 94% coverage: 24:355/355 of query aligns to 23:362/363 of 3dtgA
- active site: K199 (= K195)
- binding O-benzylhydroxylamine: F72 (= F72), Y171 (= Y170), Y204 (= Y200)
- binding pyridoxal-5'-phosphate: R96 (= R96), R189 (= R185), K199 (= K195), Y204 (= Y200), E235 (= E231), G238 (≠ T234), L263 (= L256), I266 (= I259), T267 (= T260), T309 (= T302)
3dtfA Structural analysis of mycobacterial branched chain aminotransferase- implications for inhibitor design (see paper)
41% identity, 94% coverage: 24:355/355 of query aligns to 23:362/363 of 3dtfA
A0R066 Branched-chain-amino-acid aminotransferase; BCAT; EC 2.6.1.42 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see 2 papers)
41% identity, 94% coverage: 24:355/355 of query aligns to 28:367/368 of A0R066
- R101 (= R96) binding
- Y209 (= Y200) binding
- K299 (≠ E287) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
- T314 (= T302) binding
2hdkB Crystal structure of cys315ala-cys318ala mutant of human mitochondrial branched chain aminotransferase (see paper)
35% identity, 99% coverage: 6:355/355 of query aligns to 7:363/363 of 2hdkB
- active site: K200 (= K195)
- binding 2-oxo-4-methylpentanoic acid: G310 (= G301), T311 (= T302), A312 (= A303)
- binding pyridoxal-5'-phosphate: R97 (= R96), K200 (= K195), Y205 (= Y200), E235 (= E231), T238 (= T234), L264 (= L256), G266 (= G258), V267 (≠ I259), V268 (≠ T260), G310 (= G301), T311 (= T302)
5bwtA X-ray crystal structure at 2.20a resolution of human mitochondrial branched chain aminotransferase (bcatm) complexed with a pyrazolopyrimidinone fragment and an internal aldimine linked plp. (see paper)
35% identity, 99% coverage: 6:355/355 of query aligns to 7:360/360 of 5bwtA
- active site: K197 (= K195)
- binding 5-ethyl-2-methyl-7-oxo-4,7-dihydropyrazolo[1,5-a]pyrimidine-3-carbonitrile: Y171 (= Y170), T235 (= T234), M236 (= M235), A309 (= A303), C310 (≠ A304)
- binding pyridoxal-5'-phosphate: R97 (= R96), K197 (= K195), Y202 (= Y200), E232 (= E231), T235 (= T234), M236 (= M235), N237 (= N236), L261 (= L256), G263 (= G258), V264 (≠ I259), V265 (≠ T260), G307 (= G301), T308 (= T302)
O15382 Branched-chain-amino-acid aminotransferase, mitochondrial; BCAT(m); Placental protein 18; PP18; EC 2.6.1.42 from Homo sapiens (Human) (see 6 papers)
35% identity, 99% coverage: 6:355/355 of query aligns to 36:392/392 of O15382
- Y168 (= Y138) binding
- R170 (= R140) to Q: in HVLI; reduced catalytic activity; dbSNP:rs749866079
- T186 (≠ S155) to R: in dbSNP:rs11548193
- K229 (= K195) modified: N6-(pyridoxal phosphate)lysine
- E264 (= E231) to K: in HVLI; reduced catalytic activity; dbSNP:rs767653663
- C342 (≠ A304) mutation to A: Reduces activity about 6-fold.
- C345 (≠ A307) mutation to A: Slight reduction of activity.
5i5yA X-ray crystal structure at 1.81a resolution of human mitochondrial branched chain aminotransferase (bcatm) complexed with an aryl acetate compound and an internal aldimine linked plp cofactor. (see paper)
34% identity, 99% coverage: 6:355/355 of query aligns to 7:363/363 of 5i5yA
- active site: K200 (= K195)
- binding {2-[(5-methyl-4-oxo-3,4-dihydrothieno[2,3-d]pyrimidine-6-carbonyl)amino]phenyl}acetic acid: F28 (= F27), Y68 (= Y67), F73 (= F72), K77 (= K76), Y139 (= Y138), V153 (≠ I152), Y171 (= Y170), T238 (= T234), T311 (= T302), A312 (= A303)
- binding pyridoxal-5'-phosphate: R97 (= R96), R190 (= R185), K200 (= K195), Y205 (= Y200), E235 (= E231), T238 (= T234), L264 (= L256), G266 (= G258), V267 (≠ I259), V268 (≠ T260), T311 (= T302)
5i5uA X-ray crystal structure at 2.40a resolution of human mitochondrial branched chain aminotransferase (bcatm) complexed with a tetrahydronaphthalenyl compound and an internal aldimine linked plp cofactor. (see paper)
34% identity, 99% coverage: 6:355/355 of query aligns to 7:363/363 of 5i5uA
- active site: K200 (= K195)
- binding 2-hydroxy-N-[(1R)-1,2,3,4-tetrahydronaphthalen-1-yl]acetamide: F28 (= F27), Y68 (= Y67), F73 (= F72), V153 (≠ I152), K200 (= K195), Y205 (= Y200), T238 (= T234), G310 (= G301), T311 (= T302), A312 (= A303)
- binding pyridoxal-5'-phosphate: R97 (= R96), R190 (= R185), K200 (= K195), Y205 (= Y200), E235 (= E231), T238 (= T234), M239 (= M235), L264 (= L256), G266 (= G258), V267 (≠ I259), V268 (≠ T260), G310 (= G301), T311 (= T302)
1kt8A Human branched chain amino acid aminotransferase (mitochondrial): three dimensional structure of enzyme in its ketimine form with the substrate l-isoleucine (see paper)
35% identity, 99% coverage: 6:355/355 of query aligns to 9:360/360 of 1kt8A
- binding n-[o-phosphono-pyridoxyl]-isoleucine: G77 (= G74), R99 (= R96), Y141 (= Y138), R187 (= R185), K197 (= K195), Y202 (= Y200), E232 (= E231), T235 (= T234), N237 (= N236), G263 (= G258), V264 (≠ I259), V265 (≠ T260), G307 (= G301), T308 (= T302)
2a1hA X-ray crystal structure of human mitochondrial branched chain aminotransferase (bcatm) complexed with gabapentin (see paper)
34% identity, 99% coverage: 6:355/355 of query aligns to 7:363/363 of 2a1hA
- active site: K200 (= K195)
- binding [1-(aminomethyl)cyclohexyl]acetic acid: Y68 (= Y67), R141 (= R140), V153 (≠ I152), T238 (= T234), G310 (= G301), T311 (= T302), A312 (= A303)
- binding pyridoxal-5'-phosphate: R97 (= R96), R190 (= R185), K200 (= K195), Y205 (= Y200), E235 (= E231), T238 (= T234), M239 (= M235), N240 (= N236), L264 (= L256), G266 (= G258), V267 (≠ I259), V268 (≠ T260), T311 (= T302)
1ktaA Human branched chain amino acid aminotransferase : three dimensional structure of the enzyme in its pyridoxamine phosphate form. (see paper)
34% identity, 99% coverage: 6:355/355 of query aligns to 9:365/365 of 1ktaA
- binding 3-methyl-2-oxobutanoic acid: F75 (= F72), K202 (= K195), Y207 (= Y200)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R99 (= R96), R192 (= R185), K202 (= K195), Y207 (= Y200), E237 (= E231), T240 (= T234), M241 (= M235), N242 (= N236), L266 (= L256), G268 (= G258), V269 (≠ I259), V270 (≠ T260), G312 (= G301), T313 (= T302)
1ekfA Crystallographic structure of human branched chain amino acid aminotransferase (mitochondrial) complexed with pyridoxal-5'- phosphate at 1.95 angstroms (orthorhombic form) (see paper)
34% identity, 99% coverage: 6:355/355 of query aligns to 9:365/365 of 1ekfA
- active site: K202 (= K195)
- binding pyridoxal-5'-phosphate: R99 (= R96), R192 (= R185), K202 (= K195), Y207 (= Y200), E237 (= E231), T240 (= T234), M241 (= M235), N242 (= N236), L266 (= L256), G268 (= G258), V269 (≠ I259), V270 (≠ T260), T313 (= T302)
5bwvA X-ray crystal structure at 1.86a resolution of human mitochondrial branched chain aminotransferase (bcatm) complexed with a pyrazolopyrimidinone compound and an internal aldimine linked plp cofactor. (see paper)
35% identity, 99% coverage: 6:355/355 of query aligns to 7:355/355 of 5bwvA
- active site: K192 (= K195)
- binding 2-[(4-chlorobenzyl)amino]-7-oxo-5-propyl-4,7-dihydropyrazolo[1,5-a]pyrimidine-3-carbonitrile: R137 (= R140), Y167 (= Y170), V172 (= V175), Q214 (= Q217), V228 (≠ S232), T230 (= T234), M231 (= M235), G302 (= G301), A304 (= A303), C305 (≠ A304), C308 (≠ A307)
- binding pyridoxal-5'-phosphate: R93 (= R96), K192 (= K195), Y197 (= Y200), E227 (= E231), T230 (= T234), N232 (= N236), L256 (= L256), G258 (= G258), V259 (≠ I259), V260 (≠ T260), G302 (= G301), T303 (= T302)
2hg8A Crystal structure of cys315ala mutant of human mitochondrial branched chain aminotransferase complexed with its substrate mimic, n-methyl leucine. (see paper)
35% identity, 99% coverage: 6:355/355 of query aligns to 7:356/356 of 2hg8A
- binding n-methylleucine: Y68 (= Y67), L151 (= L150), V153 (≠ I152)
- binding pyridoxal-5'-phosphate: R97 (= R96), K193 (= K195), Y198 (= Y200), E228 (= E231), T231 (= T234), M232 (= M235), N233 (= N236), L257 (= L256), G259 (= G258), V260 (≠ I259), V261 (≠ T260), T304 (= T302)
5bwrA X-ray crystal structure at 2.20a resolution of human mitochondrial branched chain aminotransferase (bcatm) complexed with a pyrazolopyrimidinone fragment and an internal aldimine linked plp. (see paper)
34% identity, 99% coverage: 6:355/355 of query aligns to 7:356/356 of 5bwrA
- active site: K193 (= K195)
- binding 5-benzyl-7-oxo-4,7-dihydropyrazolo[1,5-a]pyrimidine-3-carbonitrile: F73 (= F72), K193 (= K195), T231 (= T234), M232 (= M235), G303 (= G301), A305 (= A303), C306 (≠ A304)
- binding pyridoxal-5'-phosphate: R97 (= R96), R183 (= R185), K193 (= K195), Y198 (= Y200), E228 (= E231), T231 (= T234), M232 (= M235), N233 (= N236), L257 (= L256), G259 (= G258), V260 (≠ I259), V261 (≠ T260), T304 (= T302)
5i5sA X-ray crystal structure at 2.06a resolution of human mitochondrial branched chain aminotransferase (bcatm) complexed with a benzisoxazole compound and an internal aldimine linked plp cofactor. (see paper)
34% identity, 99% coverage: 6:355/355 of query aligns to 7:361/361 of 5i5sA
- active site: K198 (= K195)
- binding 2-(1,2-benzoxazol-3-yl)ethanoic acid: F26 (= F27), F71 (= F72), K198 (= K195), T236 (= T234), T309 (= T302), A310 (= A303)
- binding pyridoxal-5'-phosphate: R95 (= R96), R188 (= R185), K198 (= K195), Y203 (= Y200), E233 (= E231), T236 (= T234), M237 (= M235), N238 (= N236), L262 (= L256), G264 (= G258), V265 (≠ I259), V266 (≠ T260), G308 (= G301), T309 (= T302)
5i5xA X-ray crystal structure at 1.65a resolution of human mitochondrial branched chain aminotransferase (bcatm) complexed with a thiazole compound and pmp cofactor. (see paper)
36% identity, 93% coverage: 25:355/355 of query aligns to 23:358/358 of 5i5xA
- active site: K195 (= K195)
- binding 5-methyl-4-oxo-N-(1,3,4-thiadiazol-2-yl)-3,4-dihydrothieno[2,3-d]pyrimidine-6-carboxamide: F25 (= F27), F70 (= F72), K74 (= K76), Y136 (= Y138), V165 (= V167), Y168 (= Y170), A307 (= A303)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R94 (= R96), R185 (= R185), K195 (= K195), Y200 (= Y200), E230 (= E231), T233 (= T234), M234 (= M235), N235 (= N236), L259 (= L256), G261 (= G258), V262 (≠ I259), V263 (≠ T260), T306 (= T302)
5cr5A X-ray crystal structure at 1.61a resolution of human mitochondrial branched chain aminotransferase (bcatm) complexed with a biphenyl pyrrolidine ether compound and an internal aldimine linked plp cofactor. (see paper)
35% identity, 99% coverage: 6:355/355 of query aligns to 7:358/358 of 5cr5A
- active site: K195 (= K195)
- binding 3-({(3R)-1-[(5-bromothiophen-2-yl)carbonyl]pyrrolidin-3-yl}oxy)-N-methyl-2'-[(methylsulfonyl)amino]biphenyl-4-carboxamide: F23 (= F27), F68 (= F72), Y166 (= Y170), V175 (= V175), Q217 (= Q217), V231 (≠ S232), G232 (= G233), T233 (= T234), M234 (= M235), G305 (= G301), A307 (= A303), C311 (≠ A307)
- binding pyridoxal-5'-phosphate: R92 (= R96), K195 (= K195), Y200 (= Y200), E230 (= E231), T233 (= T234), N235 (= N236), L259 (= L256), G261 (= G258), V262 (≠ I259), V263 (≠ T260), T306 (= T302)
Query Sequence
>Echvi_2202 FitnessBrowser__Cola:Echvi_2202
MNTTIDIQIKQTSQSKLQGTDFENLSFGQVMSDHMFVADYKNGEWQDFRIEPYAPLSLNP
ANATLHYGQSVFEGLKAYKDEHNNVLIFRPDANQQRLNESADRLCIPQLPEEIFMEGLRK
LLAVDRDWIPNKPGCSLYIRPFIFATDDYLGIRPSATYKFMIFTCPVGHYYAKPVSVKVE
TKYTRAAEGGTGQAKAAGNYAGSLYPAQIAQKQGYDQLLWTDGKNHENIEESGTMNVMFI
INNTLITAPTSKGTILKGITRDSVLTLAKEKGLKVSERFLTVTELKEALENNTLQEAFGT
GTAATIAHIYKINVGDTDYDLPEKPADSFSYQVLETLDAIKYGRQEDTHGWITKV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory