Comparing Echvi_2204 FitnessBrowser__Cola:Echvi_2204 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
57% identity, 93% coverage: 3:224/240 of query aligns to 2:223/226 of 5xu1B
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
52% identity, 93% coverage: 4:225/240 of query aligns to 1:227/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
52% identity, 93% coverage: 4:225/240 of query aligns to 1:227/230 of 1l2tA
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
49% identity, 92% coverage: 4:224/240 of query aligns to 3:223/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
49% identity, 92% coverage: 4:224/240 of query aligns to 3:223/592 of 5lj7A
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
45% identity, 95% coverage: 1:228/240 of query aligns to 1:226/648 of P75831
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
42% identity, 93% coverage: 4:227/240 of query aligns to 4:227/650 of 5ws4A
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
46% identity, 83% coverage: 22:221/240 of query aligns to 17:216/223 of 2pclA
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
44% identity, 90% coverage: 4:219/240 of query aligns to 5:221/233 of P75957
7mdyC Lolcde nucleotide-bound
44% identity, 90% coverage: 4:219/240 of query aligns to 2:218/226 of 7mdyC
7arlD Lolcde in complex with lipoprotein and adp (see paper)
44% identity, 90% coverage: 4:219/240 of query aligns to 2:218/222 of 7arlD
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
43% identity, 90% coverage: 4:219/240 of query aligns to 4:220/229 of 7v8iD
8g4cB Bceabs atpgs high res tm (see paper)
42% identity, 97% coverage: 4:235/240 of query aligns to 3:235/248 of 8g4cB
7tchB Bceab e169q variant atp-bound conformation (see paper)
42% identity, 97% coverage: 4:235/240 of query aligns to 2:234/245 of 7tchB
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
41% identity, 90% coverage: 4:219/240 of query aligns to 1:213/222 of P0A9R7
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
41% identity, 90% coverage: 4:219/240 of query aligns to 1:213/219 of 8w6iD
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
41% identity, 90% coverage: 4:219/240 of query aligns to 1:213/218 of 8hd0A
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
36% identity, 94% coverage: 2:226/240 of query aligns to 1:222/229 of 6z67B
P9WQK5 Uncharacterized ABC transporter ATP-binding protein Rv0073 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 88% coverage: 14:225/240 of query aligns to 13:224/330 of P9WQK5
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
40% identity, 93% coverage: 4:226/240 of query aligns to 2:222/225 of 8iddA
>Echvi_2204 FitnessBrowser__Cola:Echvi_2204
MGKIIETKEIKKTYVMGAEKVQALKSVTIDIIKGEYVAFMGPSGSGKSTLMNIIGCLDTP
TAGNYILNNKDVSHMTENELAEIRNKEIGFVFQTFNLLPRATCLENVALPLIYAGYSKSD
REDKAFLALKSVGLEDRIHHKPNELSGGQRQRVAIARALVNDPSIILADEPTGNLDTKTS
YDIMNLFDELHQKGNTIIMVTHEDDIAHYAHRIVRLRDGLVETDQNNPNPTRNNFQPVSE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory