Comparing Echvi_2281 FitnessBrowser__Cola:Echvi_2281 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7xreC Crystal structure of dgpa
32% identity, 28% coverage: 57:190/486 of query aligns to 25:150/363 of 7xreC
Sites not aligning to the query:
7xr9A Crystal structure of dgpa with glucose (see paper)
32% identity, 23% coverage: 77:190/486 of query aligns to 28:140/344 of 7xr9A
Sites not aligning to the query:
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
27% identity, 38% coverage: 49:232/486 of query aligns to 7:190/336 of 3ec7A
Sites not aligning to the query:
4mjlD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD and d-chiro-inositol
32% identity, 30% coverage: 46:189/486 of query aligns to 4:146/339 of 4mjlD
Sites not aligning to the query:
4mioD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
32% identity, 30% coverage: 46:189/486 of query aligns to 4:146/339 of 4mioD
Sites not aligning to the query:
4mioA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
32% identity, 30% coverage: 46:189/486 of query aligns to 4:146/339 of 4mioA
Sites not aligning to the query:
4minA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD
32% identity, 30% coverage: 46:189/486 of query aligns to 4:146/339 of 4minA
Sites not aligning to the query:
7d5nB Crystal structure of inositol dehydrogenase homolog complexed with nadh and myo-inositol from azotobacter vinelandii
42% identity, 13% coverage: 95:157/486 of query aligns to 65:130/389 of 7d5nB
Sites not aligning to the query:
7d5nA Crystal structure of inositol dehydrogenase homolog complexed with nadh and myo-inositol from azotobacter vinelandii
42% identity, 13% coverage: 95:157/486 of query aligns to 65:130/379 of 7d5nA
Sites not aligning to the query:
7d5mA Crystal structure of inositol dehydrogenase homolog complexed with NAD+ from azotobacter vinelandii
42% identity, 13% coverage: 95:157/486 of query aligns to 66:131/389 of 7d5mA
Sites not aligning to the query:
6t2bB Glycoside hydrolase family 109 from akkermansia muciniphila in complex with galnac and NAD+.
29% identity, 33% coverage: 39:196/486 of query aligns to 25:195/439 of 6t2bB
Sites not aligning to the query:
3dtyA Crystal structure of an oxidoreductase from pseudomonas syringae
27% identity, 24% coverage: 78:194/486 of query aligns to 42:163/374 of 3dtyA
Sites not aligning to the query:
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
30% identity, 31% coverage: 62:213/486 of query aligns to 18:170/333 of Q2I8V6
Sites not aligning to the query:
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
30% identity, 31% coverage: 62:213/486 of query aligns to 17:169/332 of 2glxA
Sites not aligning to the query:
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
27% identity, 32% coverage: 46:201/486 of query aligns to 4:157/340 of 4n54A
Sites not aligning to the query:
3e18A Crystal structure of NAD-binding protein from listeria innocua
28% identity, 19% coverage: 52:144/486 of query aligns to 9:97/348 of 3e18A
Sites not aligning to the query:
3nt5A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor and product inosose (see paper)
30% identity, 31% coverage: 49:201/486 of query aligns to 5:158/337 of 3nt5A
Sites not aligning to the query:
3nt4A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadh and inositol (see paper)
30% identity, 31% coverage: 49:201/486 of query aligns to 5:158/337 of 3nt4A
Sites not aligning to the query:
3nt2B Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
30% identity, 31% coverage: 49:201/486 of query aligns to 5:158/337 of 3nt2B
Sites not aligning to the query:
3nt2A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
30% identity, 31% coverage: 49:201/486 of query aligns to 5:158/337 of 3nt2A
Sites not aligning to the query:
>Echvi_2281 FitnessBrowser__Cola:Echvi_2281
MKEQKPLQSGNSRRAFLKGAATAAAGFYLVPRHVLGGPGFTAPSDKIVIAGIGAGGKGQS
DINAMYQSGHAEIGYLCDVDDRRAATSRERFPKAKYYKDFRELLEKEHKNIDAVTVSTPD
HNHAVITLAAMQLGKHVYVQKPLTHDIYEARMLTEAAEKYKVVTQMGNQGSSGDGVRRMV
EWYDAGLIGEATKVWCWTDRPVWPQGIKWPEKGTTPPKELDWDLWLGTAPYKEYVDNLVP
FNWRGWWDYGTGALGDMACHIMEPPFRALGLGYPTEAECSVGSVYVGEFQRGYFPDGCPP
SSHVTLKFKMPSGKDLEFHWMDGGIQPTRPEELGPNEQMGDGGNGVIIEGTKGKMMCSTY
GINPMLLPTSREDGEKVPKTIPRVENGDNGHYAQWVKACVAGHGSKEFKELSSPFSIAGP
LTESVLMGNLAIRSYDIRKPREDNGFDYPGRGIKLVWDGPNMKVTNFDEANQFVKREYRG
DWTLNV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory