SitesBLAST
Comparing Echvi_2325 FitnessBrowser__Cola:Echvi_2325 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6pfkA Phosphofructokinase, inhibited t-state (see paper)
51% identity, 100% coverage: 1:324/324 of query aligns to 1:319/319 of 6pfkA
- active site: G11 (= G11), R72 (= R72), C73 (≠ S73), D103 (= D103), G104 (= G104), G124 (= G125), T125 (= T126), D127 (= D128), D129 (= D130), R171 (= R172)
- binding 2-phosphoglycolic acid: R21 (= R21), R25 (= R25), G58 (≠ S58), D59 (≠ N59), R154 (= R155), R211 (≠ K211), K213 (= K213)
P00512 ATP-dependent 6-phosphofructokinase; ATP-PFK; Phosphofructokinase; Phosphohexokinase; EC 2.7.1.11 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
51% identity, 100% coverage: 1:324/324 of query aligns to 1:319/319 of P00512
- RSVVR 21:25 (≠ RAVVR 21:25) binding
- D59 (≠ N59) binding
- RC 72:73 (≠ RS 72:73) binding
- D103 (= D103) binding
- TID 125:127 (= TID 126:128) binding in other chain
- R154 (= R155) binding in other chain
- R162 (= R163) binding
- MGR 169:171 (= MGR 170:172) binding in other chain
- GAE 185:187 (= GAE 186:188) binding in other chain
- R211 (≠ K211) binding in other chain
- KKH 213:215 (≠ KTS 213:215) binding in other chain
- E222 (= E222) binding in other chain
- R243 (≠ K248) binding
- HVQR 249:252 (≠ HIQR 254:257) binding in other chain
1mtoA Crystal structure of a phosphofructokinase mutant from bacillus stearothermophilus bound with fructose-6-phosphate (see paper)
51% identity, 100% coverage: 1:324/324 of query aligns to 1:319/319 of 1mtoA
- active site: G11 (= G11), R72 (= R72), C73 (≠ S73), D103 (= D103), G104 (= G104), G124 (= G125), T125 (= T126), D127 (= D128), D129 (= D130), R171 (= R172)
- binding 6-O-phosphono-beta-D-fructofuranose: D127 (= D128), R162 (= R163), M169 (= M170), R171 (= R172), E222 (= E222), R243 (≠ K248), H249 (= H254), R252 (= R257)
4pfkA Phosphofructokinase. Structure and control (see paper)
50% identity, 100% coverage: 1:324/324 of query aligns to 1:319/319 of 4pfkA
- active site: G11 (= G11), R72 (= R72), C73 (≠ S73), D103 (= D103), G104 (= G104), G124 (= G125), T125 (= T126), D127 (= D128), D129 (= D130), R171 (= R172)
- binding adenosine-5'-diphosphate: S9 (= S9), Y41 (= Y41), R72 (= R72), C73 (≠ S73), F76 (= F76), K77 (≠ R77), G104 (= G104), G108 (= G108), R154 (= R155), G185 (= G186), R211 (≠ K211), G212 (≠ T212), K213 (= K213), H215 (≠ S215)
- binding 6-O-phosphono-beta-D-fructofuranose: D127 (= D128), M169 (= M170), E222 (= E222), H249 (= H254), R252 (= R257)
- binding magnesium ion: G185 (= G186), E187 (= E188)
3pfkA Phosphofructokinase. Structure and control (see paper)
50% identity, 100% coverage: 1:324/324 of query aligns to 1:319/319 of 3pfkA
- active site: G11 (= G11), R72 (= R72), C73 (≠ S73), D103 (= D103), G104 (= G104), G124 (= G125), T125 (= T126), D127 (= D128), D129 (= D130), R171 (= R172)
- binding phosphate ion: R154 (= R155), K213 (= K213), H249 (= H254), R252 (= R257)
4i4iA Crystal structure of bacillus stearothermophilus phosphofructokinase mutant t156a bound to pep (see paper)
50% identity, 100% coverage: 1:324/324 of query aligns to 1:319/319 of 4i4iA
- active site: G11 (= G11), R72 (= R72), C73 (≠ S73), D103 (= D103), G104 (= G104), G124 (= G125), T125 (= T126), D127 (= D128), D129 (= D130), R171 (= R172)
- binding phosphoenolpyruvate: R21 (= R21), R25 (= R25), G58 (≠ S58), R154 (= R155), R211 (≠ K211), K213 (= K213), H215 (≠ S215)
5xz7A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
53% identity, 95% coverage: 1:307/324 of query aligns to 1:304/322 of 5xz7A
5xz6A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
53% identity, 95% coverage: 1:307/324 of query aligns to 1:304/318 of 5xz6A
5xzaA Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adp (see paper)
51% identity, 100% coverage: 1:324/324 of query aligns to 1:322/322 of 5xzaA
Q2FXM8 ATP-dependent 6-phosphofructokinase; ATP-PFK; Phosphofructokinase; Phosphohexokinase; EC 2.7.1.11 from Staphylococcus aureus (strain NCTC 8325 / PS 47) (see paper)
51% identity, 100% coverage: 1:324/324 of query aligns to 1:322/322 of Q2FXM8
- RC 72:73 (≠ RS 72:73) binding
- GDGS 102:105 (≠ GDGT 102:105) binding
- TID 127:129 (= TID 126:128) binding in other chain
- G150 (≠ E149) mutation to D: Exhibits higher affinity for fructose 6-phosphate and higher catalytic activity with a loss of dimer conversion; in association with A-151.
- L151 (≠ A150) mutation to A: Exhibits higher affinity for fructose 6-phosphate and higher catalytic activity with a loss of tetramer-dimer conversion; in association with D-150.
- R164 (= R163) mutation to A: Complete loss of fructose 6-phosphate binding.
- MGR 171:173 (= MGR 170:172) binding in other chain
- E224 (= E222) binding in other chain
- R245 (≠ K248) mutation to A: Complete loss of fructose 6-phosphate binding.
- HVQR 251:254 (≠ HIQR 254:257) binding in other chain
5xz9A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
53% identity, 94% coverage: 1:303/324 of query aligns to 1:300/321 of 5xz9A
- binding adenosine-5'-triphosphate: S9 (= S9), Y41 (= Y41), C73 (≠ S73), F76 (= F76), K77 (≠ R77), G102 (= G102), D103 (= D103), G104 (= G104), S105 (≠ T105), R107 (≠ T107), G108 (= G108)
1pfkA Crystal structure of the complex of phosphofructokinase from escherichia coli with its reaction products (see paper)
44% identity, 98% coverage: 1:316/324 of query aligns to 2:313/320 of 1pfkA
- active site: G12 (= G11), R73 (= R72), F74 (≠ S73), D104 (= D103), G105 (= G104), G125 (= G125), T126 (= T126), D128 (= D128), D130 (= D130), R172 (= R172)
- binding adenosine-5'-diphosphate: G11 (= G10), R22 (= R21), R26 (= R25), Y56 (≠ H55), S59 (= S58), D60 (≠ N59), R73 (= R72), F74 (≠ S73), F77 (= F76), R78 (= R77), G103 (= G102), D104 (= D103), G105 (= G104), S106 (≠ T105), M108 (≠ T107), G109 (= G108), R155 (= R155), G213 (≠ T212), K214 (= K213), H216 (≠ S215)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: G12 (= G11), R73 (= R72), T126 (= T126), D128 (= D128), M170 (= M170), E223 (= E222), H250 (= H254), R253 (= R257)
- binding magnesium ion: G186 (= G186), E188 (= E188)
P0A796 ATP-dependent 6-phosphofructokinase isozyme 1; ATP-PFK 1; Phosphofructokinase 1; 6-phosphofructokinase isozyme I; Phosphohexokinase 1; Sedoheptulose-7-phosphate kinase; EC 2.7.1.11 from Escherichia coli (strain K12) (see 2 papers)
44% identity, 98% coverage: 1:316/324 of query aligns to 2:313/320 of P0A796
- G12 (= G11) binding
- RGVVR 22:26 (≠ RAVVR 21:25) binding
- RYSVSD 55:60 (≠ SHAVSN 54:59) binding
- RF 73:74 (≠ RS 72:73) binding
- GDGS 103:106 (≠ GDGT 102:105) binding
- D104 (= D103) binding
- TID 126:128 (= TID 126:128) binding in other chain
- D128 (= D128) active site, Proton acceptor; mutation to S: 18000-fold reduction of catalytic rate.
- R155 (= R155) binding in other chain
- R163 (= R163) binding
- R172 (= R172) mutation to S: 3.4-fold reduction in turnover numbers.
- GCE 186:188 (≠ GAE 186:188) binding in other chain
- KKH 214:216 (≠ KTS 213:215) binding in other chain
- E223 (= E222) binding in other chain
- R244 (≠ K248) binding
- HIQR 250:253 (= HIQR 254:257) binding in other chain
Q01813 ATP-dependent 6-phosphofructokinase, platelet type; ATP-PFK; PFK-P; 6-phosphofructokinase type C; Phosphofructo-1-kinase isozyme C; PFK-C; Phosphohexokinase; EC 2.7.1.11 from Homo sapiens (Human) (see paper)
39% identity, 96% coverage: 2:313/324 of query aligns to 25:369/784 of Q01813
Sites not aligning to the query:
- 386 modified: Phosphoserine; S→A: Decreased interaction with ATG4B.
4xykA Crystal structure of human phosphofructokinase-1 in complex with adp, northeast structural genomics consortium target hr9275 (see paper)
39% identity, 96% coverage: 2:313/324 of query aligns to 9:353/737 of 4xykA
- active site: G18 (= G11), R81 (= R72), C82 (≠ S73), D112 (= D103), G156 (= G125), S157 (≠ T126), D159 (= D128), D161 (= D130), R203 (= R172)
- binding adenosine-5'-diphosphate: Y48 (= Y41), R81 (= R72), C82 (≠ S73), R86 (= R77), G111 (= G102), D112 (= D103), G113 (= G104), S114 (≠ T105)
- binding phosphate ion: R28 (= R21), R32 (= R25), S67 (= S58), K248 (= K213)
Sites not aligning to the query:
4xyjA Crystal structure of human phosphofructokinase-1 in complex with atp and mg, northeast structural genomics consortium target hr9275 (see paper)
39% identity, 96% coverage: 2:313/324 of query aligns to 13:357/768 of 4xyjA
- active site: G22 (= G11), R85 (= R72), C86 (≠ S73), D116 (= D103), G160 (= G125), S161 (≠ T126), D163 (= D128), D165 (= D130), R207 (= R172)
- binding adenosine-5'-triphosphate: G21 (= G10), G22 (= G11), Y52 (= Y41), C86 (≠ S73), F89 (= F76), R90 (= R77), G115 (= G102), D116 (= D103), G117 (= G104), S118 (≠ T105), G121 (= G108), S161 (≠ T126), R207 (= R172)
- binding magnesium ion: G21 (= G10), G22 (= G11), D116 (= D103), D165 (= D130)
- binding phosphate ion: R32 (= R21), R36 (= R25), S72 (≠ N59), G221 (= G186), K252 (= K213)
Sites not aligning to the query:
4xyjF Crystal structure of human phosphofructokinase-1 in complex with atp and mg, northeast structural genomics consortium target hr9275 (see paper)
39% identity, 96% coverage: 2:313/324 of query aligns to 11:355/761 of 4xyjF
- active site: G20 (= G11), R83 (= R72), C84 (≠ S73), D114 (= D103), G158 (= G125), S159 (≠ T126), D161 (= D128), D163 (= D130), R205 (= R172)
- binding adenosine-5'-triphosphate: G20 (= G11), Y50 (= Y41), R83 (= R72), C84 (≠ S73), F87 (= F76), R88 (= R77), G113 (= G102), D114 (= D103), G115 (= G104), S116 (≠ T105), G119 (= G108), S159 (≠ T126)
- binding magnesium ion: G19 (= G10), G20 (= G11), G112 (= G101), D114 (= D103), G158 (= G125), D163 (= D130), R205 (= R172)
- binding phosphate ion: R30 (= R21), R34 (= R25), S69 (= S58), S70 (≠ N59), G219 (= G186), K250 (= K213)
Sites not aligning to the query:
4rh3A Amppcp-bound structure of human platelet phosphofructokinase in an r- state, crystal form ii (see paper)
39% identity, 96% coverage: 4:313/324 of query aligns to 3:345/731 of 4rh3A
- active site: G10 (= G11), R73 (= R72), C74 (≠ S73), D104 (= D103), G148 (= G125), S149 (≠ T126), D151 (= D128), D153 (= D130), R195 (= R172)
- binding phosphomethylphosphonic acid adenylate ester: G9 (= G10), R73 (= R72), C74 (≠ S73), F77 (= F76), R78 (= R77), G103 (= G102), D104 (= D103), G105 (= G104), S106 (≠ T105), G109 (= G108)
- binding phosphate ion: K240 (= K213)
Sites not aligning to the query:
P17858 ATP-dependent 6-phosphofructokinase, liver type; ATP-PFK; PFK-L; 6-phosphofructokinase type B; Phosphofructo-1-kinase isozyme B; PFK-B; Phosphohexokinase; EC 2.7.1.11 from Homo sapiens (Human) (see 3 papers)
39% identity, 96% coverage: 2:313/324 of query aligns to 16:360/780 of P17858
- G81 (= G65) natural variant: G -> A
- R151 (vs. gap) to W: in dbSNP:rs755851304
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 527 T→A: Does not affect GlcNAcylation.
- 529 modified: carbohydrate, O-linked (GlcNAc) serine; S→A: Prevents GlcNAcylation and enhance enzyme activity.
7lw1A Human phosphofructokinase-1 liver type bound to activator na-11 (see paper)
39% identity, 96% coverage: 2:313/324 of query aligns to 6:350/744 of 7lw1A
- binding adenosine-5'-diphosphate: R78 (= R72), C79 (≠ S73), T83 (≠ R77), G108 (= G102), G110 (= G104), S111 (≠ T105), G114 (= G108), I117 (≠ V111)
- binding 6-O-phosphono-beta-D-fructofuranose: I155 (= I127), D156 (= D128), R191 (= R163), M198 (= M170), R200 (= R172), E254 (= E222), R282 (≠ K248), H288 (= H254), R291 (= R257)
- binding N-{(11S)-2-[2-(5-hydroxypent-1-yn-1-yl)phenyl]-4H,10H-pyrazolo[5,1-c][1,4]benzoxazepin-7-yl}acetamide: M164 (≠ F136), F298 (≠ K264), I301 (≠ M267), K305 (≠ R271), N331 (≠ D294)
Sites not aligning to the query:
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: 399, 460, 519, 555, 562, 618, 644, 650, 724
- binding N-{(11S)-2-[2-(5-hydroxypent-1-yn-1-yl)phenyl]-4H,10H-pyrazolo[5,1-c][1,4]benzoxazepin-7-yl}acetamide: 527, 532, 535, 568, 660, 730, 734
Query Sequence
>Echvi_2325 FitnessBrowser__Cola:Echvi_2325
MKKIAVLTSGGDAPGMNACIRAVVRTGIFHGMEMYGIMYGYDGMINGEIQKMESHAVSNI
VQRGGTILKSARSEKFRTKEGRKIAYEQLQKHGIEGLVAIGGDGTFTGAKVFYEEYGIPT
IGCPGTIDNDIYGTDFTIGFDTAINTALEAIDKIRDTAAAHDRIFFIEVMGRDSGYIAVE
CGLGGGAEMVMVPETKTTLHEVVEKLKGSRKTKTSSVIVVAEGDEEGSAAEIMEKVKNII
NDDTKDFKVTTLGHIQRGGNPTGKDRMLASRCGMAAVEGLMNGQANCMAGIIHDEVVYTS
FEDCITKSKPLNKDTLKLIEILSI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory