SitesBLAST
Comparing Echvi_2328 FitnessBrowser__Cola:Echvi_2328 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5u4qA 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
59% identity, 100% coverage: 1:346/346 of query aligns to 2:321/321 of 5u4qA
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D32 (= D31), N33 (≠ S32), N35 (= N34), Y38 (= Y37), K43 (= K42), D61 (≠ K76), L62 (= L77), L83 (= L98), A84 (= A99), A85 (= A100), A118 (= A140), Y145 (= Y167), K149 (= K171), F172 (= F194), F173 (= F195), T174 (= T196), V175 (= V197), R181 (= R203)
5u4qB 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
57% identity, 100% coverage: 1:345/346 of query aligns to 2:304/304 of 5u4qB
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D32 (= D31), N33 (≠ S32), N35 (= N34), Y38 (= Y37), K43 (= K42), D61 (≠ K76), L62 (= L77), L83 (= L98), A84 (= A99), A85 (= A100), A123 (= A140), Y150 (= Y167), K154 (= K171), F177 (= F194), V180 (= V197), R186 (= R203), M189 (= M206)
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
34% identity, 100% coverage: 1:345/346 of query aligns to 1:315/321 of 6zllA
- active site: T126 (≠ S142), S127 (= S143), S128 (= S144), Y149 (= Y167), K153 (= K171)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D32 (= D31), H33 (≠ S32), F34 (≠ I33), I35 (≠ N34), K43 (= K42), D62 (≠ K76), I63 (≠ L77), L81 (= L98), A82 (= A99), A83 (= A100), I124 (≠ A140), T126 (≠ S142), Y149 (= Y167), K153 (= K171), Y176 (≠ F194), V179 (= V197), R185 (= R203), M188 (= M206)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (≠ A102), V87 (= V104), R88 (= R105), T126 (≠ S142), S127 (= S143), Y149 (= Y167), T178 (= T196), R185 (= R203), A189 (= A207), R192 (≠ I210), T204 (≠ K222), F206 (= F224), Q211 (≠ M229), R213 (= R231), I250 (≠ L280), E276 (≠ D306)
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
34% identity, 99% coverage: 1:344/346 of query aligns to 1:314/314 of 6zldA
- active site: T126 (≠ S142), S127 (= S143), S128 (= S144), Y149 (= Y167), K153 (= K171)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D32 (= D31), H33 (≠ S32), F34 (≠ I33), I35 (≠ N34), K43 (= K42), D62 (≠ K76), I63 (≠ L77), L81 (= L98), A82 (= A99), A83 (= A100), I124 (≠ A140), T126 (≠ S142), K153 (= K171), Y176 (≠ F194), T178 (= T196), R185 (= R203), M188 (= M206)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (≠ A102), R88 (= R105), T126 (≠ S142), S127 (= S143), S128 (= S144), Y149 (= Y167), F177 (= F195), T178 (= T196), R185 (= R203), M188 (= M206), A189 (= A207), R192 (≠ I210), T204 (≠ K222), F206 (= F224), Q211 (≠ M229), R213 (= R231), I250 (≠ L280), E276 (≠ D306)
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
34% identity, 99% coverage: 1:344/346 of query aligns to 1:314/314 of 6zl6A
- active site: T126 (≠ S142), S127 (= S143), S128 (= S144), Y149 (= Y167), K153 (= K171)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D32 (= D31), H33 (≠ S32), F34 (≠ I33), I35 (≠ N34), K43 (= K42), D62 (≠ K76), I63 (≠ L77), L81 (= L98), A82 (= A99), A83 (= A100), I124 (≠ A140), T126 (≠ S142), K153 (= K171), Y176 (≠ F194), T178 (= T196), V179 (= V197), R185 (= R203), M188 (= M206)
- binding uridine-5'-diphosphate: T178 (= T196), A189 (= A207), R192 (≠ I210), T204 (≠ K222), F206 (= F224), Q211 (≠ M229), R213 (= R231), I250 (≠ L280), E276 (≠ D306)
6zljA Crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and NAD (see paper)
33% identity, 99% coverage: 1:344/346 of query aligns to 1:314/314 of 6zljA
- active site: T126 (≠ S142), S127 (= S143), S128 (= S144), F149 (≠ Y167), K153 (= K171)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D32 (= D31), H33 (≠ S32), F34 (≠ I33), I35 (≠ N34), K43 (= K42), D62 (≠ K76), I63 (≠ L77), L81 (= L98), A82 (= A99), A83 (= A100), I124 (≠ A140), T126 (≠ S142), K153 (= K171), Y176 (≠ F194), T178 (= T196), V179 (= V197), R185 (= R203), M188 (= M206)
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: P85 (≠ A102), R88 (= R105), T126 (≠ S142), S127 (= S143), S128 (= S144), F149 (≠ Y167), F177 (= F195), T178 (= T196), R185 (= R203), M188 (= M206), A189 (= A207), R192 (≠ I210), T204 (≠ K222), F206 (= F224), Q211 (≠ M229), R213 (= R231), I250 (≠ L280), E276 (≠ D306)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
29% identity, 99% coverage: 1:341/346 of query aligns to 1:305/309 of 4zrnA
- active site: T117 (≠ S142), G119 (vs. gap), A120 (≠ S144), Y143 (= Y167), K147 (= K171), Y181 (vs. gap), G185 (≠ M206)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (= D31), N32 (≠ S32), S34 (≠ N34), S35 (≠ D35), G36 (≠ Q60), S51 (≠ K76), I52 (≠ L77), L73 (= L98), A74 (= A99), A75 (= A100), T92 (≠ A117), S115 (≠ A140), S116 (= S141), Y143 (= Y167), K147 (= K171), Y170 (≠ F194), V173 (= V197)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S142), G119 (vs. gap), A120 (≠ S144), Y143 (= Y167), N172 (≠ T196), G185 (≠ M206), V186 (≠ A207), H201 (≠ K222), F203 (= F224), Y208 (≠ M229), R210 (= R231), V244 (≠ L280), R267 (≠ Q303), D270 (= D306)
7ys9A Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis
33% identity, 99% coverage: 1:341/346 of query aligns to 1:309/310 of 7ys9A
- binding galactose-uridine-5'-diphosphate: I81 (≠ A102), R84 (= R105), S121 (= S142), G123 (≠ S143), Y146 (= Y167), A174 (≠ F195), N175 (≠ T196), A187 (vs. gap), G188 (≠ M206), V189 (≠ A207), F193 (= F211), R204 (≠ K222), F206 (= F224), N211 (≠ M229), R213 (= R231), D248 (≠ L280), R271 (≠ Q303)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (= D31), N32 (= N40), A34 (≠ K42), T35 (≠ L43), G36 (≠ A44), D56 (≠ K76), I57 (≠ L77), L77 (= L98), A78 (= A99), A79 (= A100), I81 (≠ A102), T119 (≠ A140), Y146 (= Y167), K150 (= K171), P173 (≠ F194), A174 (≠ F195), V176 (= V197)
- binding uridine-5'-diphosphate-glucose: I81 (≠ A102), R84 (= R105), S121 (= S142), G123 (≠ S143), Y146 (= Y167), A174 (≠ F195), N175 (≠ T196), A187 (vs. gap), G188 (≠ M206), V189 (≠ A207), F193 (= F211), R204 (≠ K222), F206 (= F224), N211 (≠ M229), R213 (= R231), D248 (≠ L280), R271 (≠ Q303)
7ysmA Crystal structure of udp-glucose 4-epimerase (rv3634c) co-crystallized with udp-n-acetylglucosamine from mycobacterium tuberculosis
33% identity, 99% coverage: 1:341/346 of query aligns to 1:309/311 of 7ysmA
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (= D31), N32 (= N40), T35 (≠ L43), G36 (≠ A44), D56 (≠ K76), I57 (≠ L77), L77 (= L98), A78 (= A99), A79 (= A100), I81 (≠ A102), T119 (≠ A140), Y146 (= Y167), K150 (= K171), P173 (≠ F194), N175 (≠ T196), V176 (= V197)
- binding uridine-diphosphate-n-acetylgalactosamine: I81 (≠ A102), R84 (= R105), S121 (= S142), G123 (≠ S143), S124 (= S144), Y146 (= Y167), A174 (≠ F195), N175 (≠ T196), G188 (≠ M206), V189 (≠ A207), F193 (= F211), R204 (≠ K222), V205 (= V223), F206 (= F224), N211 (≠ M229), R213 (= R231), D248 (≠ L280), R271 (≠ Q303)
7ystA Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chain b from mycobacterium tuberculosis
33% identity, 99% coverage: 1:341/346 of query aligns to 1:309/312 of 7ystA
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (= D31), N32 (= N40), T35 (≠ L43), G36 (≠ A44), D56 (≠ K76), I57 (≠ L77), L77 (= L98), A78 (= A99), A79 (= A100), I81 (≠ A102), V96 (≠ A117), T119 (≠ A140), Y146 (= Y167), K150 (= K171), P173 (≠ F194), A174 (≠ F195), N175 (≠ T196), V176 (= V197)
- binding uridine-5'-diphosphate-glucose: I81 (≠ A102), R84 (= R105), S121 (= S142), G123 (≠ S143), Y146 (= Y167), A174 (≠ F195), N175 (≠ T196), A187 (vs. gap), G188 (≠ M206), V189 (≠ A207), F193 (= F211), R204 (≠ K222), V205 (= V223), F206 (= F224), R213 (= R231), D248 (≠ L280), R271 (≠ Q303)
1sb9A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-glucose (see paper)
30% identity, 98% coverage: 3:340/346 of query aligns to 18:335/340 of 1sb9A
- active site: S141 (= S142), S142 (= S143), S143 (= S144), Y165 (= Y167), K169 (= K171), N203 (≠ D205)
- binding nicotinamide-adenine-dinucleotide: G22 (= G7), G25 (= G10), F26 (= F11), I27 (= I12), D46 (= D31), N47 (≠ S32), F48 (≠ I33), T50 (≠ D35), G51 (≠ Y36), D77 (≠ K76), I78 (≠ L77), Q97 (≠ L98), A99 (= A100), T116 (≠ A117), A139 (= A140), A140 (≠ S141), Y165 (= Y167), K169 (= K171), Y192 (≠ F194), N194 (≠ T196), V195 (= V197)
- binding uridine-5'-diphosphate-glucose: S141 (= S142), Y165 (= Y167), N194 (≠ T196), A208 (vs. gap), V209 (vs. gap), W213 (≠ F211), Y224 (≠ K222), I225 (≠ V223), N226 (≠ F224), L270 (= L280), R298 (≠ Q303), D301 (= D306)
1sb8A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-n-acetylgalactosamine (see paper)
30% identity, 98% coverage: 3:340/346 of query aligns to 19:336/341 of 1sb8A
- active site: S142 (= S142), S143 (= S143), S144 (= S144), Y166 (= Y167), K170 (= K171), N204 (≠ D205)
- binding nicotinamide-adenine-dinucleotide: G23 (= G7), G26 (= G10), F27 (= F11), I28 (= I12), D47 (= D31), N48 (≠ S32), F49 (≠ I33), T51 (≠ D35), G52 (≠ Y36), D78 (≠ K76), I79 (≠ L77), Q98 (≠ L98), A100 (= A100), T117 (≠ A117), A140 (= A140), A141 (≠ S141), Y166 (= Y167), K170 (= K171), Y193 (≠ F194), N195 (≠ T196), V196 (= V197)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (≠ G103), S142 (= S142), S143 (= S143), S144 (= S144), Y166 (= Y167), N195 (≠ T196), A209 (≠ I210), V210 (vs. gap), W214 (≠ F211), Y225 (≠ K222), I226 (≠ V223), N227 (≠ F224), R234 (= R231), L271 (= L280), R299 (≠ Q303), D302 (= D306), S306 (≠ T310)
Q7BJX9 UDP-N-acetylglucosamine 4-epimerase; UDP-GalNAc 4-epimerase; EC 5.1.3.7 from Plesiomonas shigelloides (Aeromonas shigelloides) (see 2 papers)
29% identity, 98% coverage: 3:340/346 of query aligns to 22:339/345 of Q7BJX9
- GVAGFI 26:31 (= GVAGFI 7:12) binding
- DNFSTG 50:55 (≠ DSINDY 31:36) binding
- DI 81:82 (≠ KL 76:77) binding
- QAA 101:103 (≠ LAA 98:100) binding
- T120 (≠ A117) binding
- SS 145:146 (= SS 142:143) binding
- S147 (= S144) mutation to T: No effect on epimerase activity.
- Y169 (= Y167) binding
- K173 (= K171) binding
- YFN 196:198 (≠ FFT 194:196) binding
- V199 (= V197) binding
- VIPK 213:216 (vs. gap) binding
- YIN 228:230 (≠ KVF 222:224) binding
- S236 (≠ K230) mutation to G: No effect on epimerase activity.
- R237 (= R231) binding
- R271 (≠ K259) mutation to G: No effect on epimerase activity.
- RSGD 302:305 (≠ QPGD 303:306) binding
- R307 (≠ P308) mutation to A: No effect on epimerase activity.
- H308 (≠ A309) mutation to A: No effect on epimerase activity.
- S309 (≠ T310) mutation to Y: Abolishes epimerase activity.
3ruhA Alternative analogs as viable substrates of udp-hexose 4-epimerases
29% identity, 98% coverage: 3:340/346 of query aligns to 19:331/336 of 3ruhA
- active site: S142 (= S142), S143 (= S143), S144 (= S144), Y166 (= Y167), K170 (= K171), N204 (≠ D205)
- binding nicotinamide-adenine-dinucleotide: G23 (= G7), G26 (= G10), F27 (= F11), I28 (= I12), D47 (= D31), N48 (≠ S32), S50 (≠ N34), T51 (≠ D35), G52 (≠ Y36), D78 (≠ K76), I79 (≠ L77), Q98 (≠ L98), A99 (= A99), A100 (= A100), T117 (≠ A117), A140 (= A140), A141 (≠ S141), S142 (= S142), Y166 (= Y167), K170 (= K171), Y193 (≠ F194), V196 (= V197)
- binding [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl][(2R,3R,4R,5R,6R)-6-(hydroxymethyl)-4,5-bis(oxidanyl)-3-(2-oxidanylidenepropyl)oxan-2-yl] hydrogen phosphate: G102 (≠ A102), S103 (≠ G103), S142 (= S142), S143 (= S143), S144 (= S144), Y166 (= Y167), Y193 (≠ F194), N195 (≠ T196), A209 (≠ I210), V210 (vs. gap), K213 (vs. gap), W214 (≠ F211), Y225 (≠ K222), I226 (≠ V223), N227 (≠ F224), R234 (= R231), L271 (vs. gap), R294 (≠ Q303), D297 (= D306), V298 (= V307), S301 (≠ T310)
3rufA Alternative analogs as viable substrates of udp-hexose 4-epimerases
29% identity, 98% coverage: 3:340/346 of query aligns to 19:331/336 of 3rufA
- active site: S142 (= S142), S143 (= S143), S144 (= S144), Y166 (= Y167), K170 (= K171), N204 (≠ D205)
- binding nicotinamide-adenine-dinucleotide: G23 (= G7), G26 (= G10), F27 (= F11), I28 (= I12), D47 (= D31), N48 (≠ S32), S50 (≠ N34), T51 (≠ D35), G52 (≠ Y36), D78 (≠ K76), I79 (≠ L77), Q98 (≠ L98), A99 (= A99), A100 (= A100), T117 (≠ A117), A140 (= A140), Y166 (= Y167), K170 (= K171), Y193 (≠ F194), V196 (= V197)
- binding uridine-5'-diphosphate: N195 (≠ T196), A209 (≠ I210), V210 (vs. gap), K213 (vs. gap), W214 (≠ F211), Y225 (≠ K222), I226 (≠ V223), N227 (≠ F224), R234 (= R231), L271 (vs. gap), R294 (≠ Q303), D297 (= D306)
3lu1A Crystal structure analysis of wbgu: a udp-galnac 4-epimerase (see paper)
29% identity, 98% coverage: 3:340/346 of query aligns to 19:331/336 of 3lu1A
- active site: S142 (= S142), S143 (= S143), S144 (= S144), Y166 (= Y167), K170 (= K171), N204 (≠ D205)
- binding glycine: Q135 (≠ K135), K187 (≠ P188)
- binding nicotinamide-adenine-dinucleotide: G23 (= G7), G26 (= G10), F27 (= F11), I28 (= I12), D47 (= D31), N48 (≠ S32), S50 (≠ N34), T51 (≠ D35), G52 (≠ Y36), D78 (≠ K76), I79 (≠ L77), Q98 (≠ L98), A99 (= A99), A100 (= A100), A140 (= A140), A141 (≠ S141), S142 (= S142), Y166 (= Y167), K170 (= K171), Y193 (≠ F194), N195 (≠ T196)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (≠ G103), S142 (= S142), S143 (= S143), S144 (= S144), Y166 (= Y167), N195 (≠ T196), V210 (vs. gap), W214 (≠ F211), Y225 (≠ K222), I226 (≠ V223), N227 (≠ F224), R234 (= R231), L271 (vs. gap), R294 (≠ Q303), D297 (= D306)
6kv9A Moee5 in complex with udp-glucuronic acid and NAD (see paper)
29% identity, 98% coverage: 4:341/346 of query aligns to 4:296/299 of 6kv9A
- active site: S110 (= S142), S111 (= S143), S112 (= S144), Y133 (= Y167), K137 (= K171)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (= D31), R32 (≠ S32), R33 (≠ A54), D47 (≠ K76), L48 (= L77), L66 (= L98), A67 (= A99), A68 (= A100), P70 (≠ A102), C85 (≠ A117), A108 (= A140), S109 (= S141), K137 (= K171), F162 (= F194), T164 (= T196), V165 (= V197), R171 (= R203), M174 (= M206)
- binding uridine-5'-diphosphate-glucuronic acid: P70 (≠ A102), R73 (= R105), S110 (= S142), S111 (= S143), Y133 (= Y167), T164 (= T196), R171 (= R203), M174 (= M206), F175 (≠ A207), R178 (≠ I210), E190 (≠ K222), I191 (≠ V223), Y192 (≠ F224), Q197 (≠ M229), R199 (= R231), V235 (≠ L280), D261 (= D306)
6kvcA Moee5 in complex with udp-glucose and NAD (see paper)
29% identity, 98% coverage: 4:341/346 of query aligns to 4:295/299 of 6kvcA
- active site: S109 (= S142), S110 (= S143), S111 (= S144), Y132 (= Y167), K136 (= K171)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (= D31), R32 (≠ S32), R33 (≠ D52), D46 (= D79), L47 (≠ G80), L65 (= L98), A66 (= A99), A67 (= A100), P69 (≠ A102), A107 (= A140), S109 (= S142), K136 (= K171), F161 (= F194), T163 (= T196), V164 (= V197), R170 (= R203), M173 (= M206)
- binding uridine-5'-diphosphate-glucose: P69 (≠ A102), R72 (= R105), S109 (= S142), S110 (= S143), Y132 (= Y167), T163 (= T196), M173 (= M206), F174 (≠ A207), R177 (≠ I210), E189 (≠ K222), I190 (≠ V223), Y191 (≠ F224), Q196 (≠ M229), R198 (= R231), D260 (= D306)
8du1A Crystal structure of NAD bound dtdp-glucose 4,6-dehydratase from elizabethkingia anophelis
26% identity, 98% coverage: 4:342/346 of query aligns to 7:339/361 of 8du1A
- binding nicotinamide-adenine-dinucleotide: G10 (= G7), G13 (= G10), F14 (= F11), I15 (= I12), D36 (≠ I33), A37 (≠ N34), L38 (≠ D35), T39 (≠ Y36), G42 (≠ V39), D62 (≠ K76), I63 (≠ L77), L84 (= L98), A85 (= A99), A86 (= A100), T103 (≠ A117), S143 (= S141), T144 (≠ S142), Y169 (= Y167), K173 (= K171), C196 (≠ F194)
6dntA Udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid (see paper)
29% identity, 97% coverage: 4:340/346 of query aligns to 7:306/310 of 6dntA
- active site: S120 (= S142), S121 (= S143), A122 (≠ S144), Y144 (= Y167), K148 (= K171), A187 (= A207)
- binding (2R)-2-{[(2R,3R,4R,5S,6R)-3-(acetylamino)-2-{[(S)-{[(R)-{[(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methoxy}(hydroxy)phosphoryl]oxy}(hydroxy)phosphoryl]oxy}-5-hydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-4-yl]oxy}propanoic acid: A80 (= A102), S120 (= S142), S121 (= S143), Y144 (= Y167), F172 (= F195), N173 (≠ T196), A187 (= A207), V188 (≠ L208), K191 (≠ I210), V203 (≠ K222), I204 (≠ V223), Y205 (≠ F224), Q210 (≠ M229), R212 (= R231), I246 (≠ L280), R269 (≠ Q303), D272 (= D306)
- binding nicotinamide-adenine-dinucleotide: G10 (= G7), G13 (= G10), F14 (= F11), I15 (= I12), D33 (= D31), N34 (= N40), L35 (= L41), S36 (≠ K42), S37 (≠ L43), G38 (≠ A44), D57 (≠ K76), L58 (= L77), L76 (= L98), A77 (= A99), A78 (= A100), A80 (= A102), S118 (≠ A140), S119 (= S141), Y144 (= Y167), K148 (= K171), Y171 (≠ F194), V174 (= V197)
- binding zinc ion: E209 (≠ K228), H275 (≠ A309)
Query Sequence
>Echvi_2328 FitnessBrowser__Cola:Echvi_2328
MKFLVTGVAGFIGHGLSKKLLQEGHQVVGIDSINDYYDVNLKLARLKDLGIDDAPISEHQ
KVASTDKSCFEFVKMKLEDGDEMNALFEAERFDIVVNLAAQAGVRYSLENPRAYVDANIV
GFVNLLEACRHHPVKHLVYASSSSVYGANKKMPFSTSDNVDHPVSLYAASKKSNELMAHT
YSHLYGVPTTGLRFFTVYGPWGRPDMALFIFTKAILNGKPLKVFNYGKMKRDFTYVDDIV
EGVYRTALVPPKGQQEGDKEDLSGAPYRLFNIGNSKSVNLMDFIRAIEKATGKEAVLEML
PMQPGDVPATYADVSALSEVTGYKPNTRVEDGVANFVNWYRDYYQV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory