SitesBLAST
Comparing Echvi_2361 FitnessBrowser__Cola:Echvi_2361 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ho9A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-galactose and utp
66% identity, 100% coverage: 1:284/285 of query aligns to 1:285/294 of 4ho9A
- binding galactose-uridine-5'-diphosphate: L6 (= L6), G8 (= G8), G9 (= G9), Q80 (= Q80), P83 (= P83), G85 (= G85), L86 (= L86), L106 (= L106), D108 (= D108), G144 (= G143), E159 (= E158), K160 (= K159), V170 (= V169), R192 (= R191), W221 (= W220)
- binding uridine 5'-triphosphate: L43 (≠ M43), G113 (= G113), H114 (≠ S114), G115 (= G115), T117 (≠ Q117), G216 (≠ S215), R217 (= R216), G218 (= G217), I254 (≠ V253)
4ho4A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine and glucose-1-phosphate
66% identity, 100% coverage: 1:284/285 of query aligns to 1:285/289 of 4ho4A
4ho6A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-glucose and utp
66% identity, 100% coverage: 1:284/285 of query aligns to 1:285/288 of 4ho6A
- binding uridine-5'-diphosphate-glucose: L6 (= L6), G8 (= G8), G9 (= G9), Q80 (= Q80), P83 (= P83), G85 (= G85), D108 (= D108), G144 (= G143), E159 (= E158), K160 (= K159), V170 (= V169), R192 (= R191)
- binding uridine 5'-triphosphate: L43 (≠ M43), Y112 (= Y112), G113 (= G113), H114 (≠ S114), G115 (= G115), T117 (≠ Q117), E253 (= E252), I254 (≠ V253)
4ho5A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with tdp-glucose
66% identity, 100% coverage: 1:284/285 of query aligns to 1:285/288 of 4ho5A
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: L6 (= L6), G8 (= G8), G9 (= G9), Q24 (= Q24), Q80 (= Q80), P83 (= P83), G85 (= G85), L86 (= L86), L106 (= L106), D108 (= D108), Y112 (= Y112), G113 (= G113), H114 (≠ S114), G115 (= G115), F116 (≠ L116), T117 (≠ Q117), F143 (≠ Y142), G144 (= G143), E159 (= E158), K160 (= K159), V170 (= V169), G216 (≠ S215), R217 (= R216), G218 (= G217), W221 (= W220), E253 (= E252), I254 (≠ V253)
4ho3A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine triphosphate
66% identity, 100% coverage: 1:284/285 of query aligns to 1:285/288 of 4ho3A
- binding thymidine-5'-triphosphate: L6 (= L6), G8 (= G8), G9 (= G9), G11 (= G11), T12 (= T12), R13 (= R13), Q24 (= Q24), L43 (≠ M43), Q80 (= Q80), P83 (= P83), G85 (= G85), L86 (= L86), D108 (= D108), Y112 (= Y112), G113 (= G113), H114 (≠ S114), G115 (= G115), F116 (≠ L116), T117 (≠ Q117), E194 (= E193), E253 (= E252), I254 (≠ V253), R257 (≠ H256)
P26393 Glucose-1-phosphate thymidylyltransferase; dTDP-glucose pyrophosphorylase; Ep; dTDP-glucose synthase; EC 2.7.7.24 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
65% identity, 98% coverage: 2:281/285 of query aligns to 5:285/292 of P26393
- T201 (= T197) mutation to A: Two-fold increase in the conversion of 2-acetamido-2-deoxy-alpha-D-glucopyranosyl phosphate.
- W224 (= W220) mutation to H: Is able to convert both 6-acetamido-6-deoxy-alpha-D-glucopyranosyl phosphate and alpha-D-glucopyranuronic acid 1-(dihydrogen phosphate), which are not accepted by the wild-type.
1iinA Thymidylyltransferase complexed with udp-glucose (see paper)
65% identity, 98% coverage: 2:281/285 of query aligns to 5:285/289 of 1iinA
- binding uridine-5'-diphosphate-glucose: L9 (= L6), G11 (= G8), G12 (= G9), R16 (= R13), Q83 (= Q80), P86 (= P83), D87 (≠ E84), G88 (= G85), L89 (= L86), L109 (= L106), D111 (= D108), Y146 (= Y142), G147 (= G143), E162 (= E158), K163 (= K159), V173 (= V169), R195 (= R191), W224 (= W220)
1iimA Thymidylyltransferase complexed with ttp (see paper)
65% identity, 98% coverage: 2:281/285 of query aligns to 5:285/289 of 1iimA
- binding thymidine-5'-triphosphate: L9 (= L6), G11 (= G8), G12 (= G9), S13 (= S10), G14 (= G11), T15 (= T12), R16 (= R13), Q27 (= Q24), Q83 (= Q80), P86 (= P83), G88 (= G85), L89 (= L86), D111 (= D108), Y115 (= Y112), G116 (= G113), H117 (≠ S114), P120 (≠ Q117), G219 (≠ S215), R220 (= R216), G221 (= G217), S252 (≠ G248), E256 (= E252), I257 (≠ V253)
3pkpA Q83s variant of s. Enterica rmla with datp (see paper)
65% identity, 98% coverage: 2:281/285 of query aligns to 5:285/290 of 3pkpA
- binding 2'-deoxyadenosine 5'-triphosphate: G11 (= G8), G12 (= G9), S13 (= S10), G14 (= G11), T15 (= T12), R16 (= R13), K26 (= K23), Q27 (= Q24), S83 (≠ Q80), P86 (= P83), G110 (= G107), D111 (= D108)
3pkpB Q83s variant of s. Enterica rmla with datp (see paper)
65% identity, 98% coverage: 2:281/285 of query aligns to 4:284/289 of 3pkpB
- binding 2'-deoxyadenosine 5'-triphosphate: G10 (= G8), G11 (= G9), S12 (= S10), G13 (= G11), T14 (= T12), R15 (= R13), K25 (= K23), Q26 (= Q24), S82 (≠ Q80), P85 (= P83), G109 (= G107), D110 (= D108)
- binding magnesium ion: D110 (= D108), D225 (= D222)
1h5sB Thymidylyltransferase complexed with tmp (see paper)
65% identity, 98% coverage: 2:281/285 of query aligns to 5:285/291 of 1h5sB
- binding thymidine-5'-phosphate: L9 (= L6), G11 (= G8), G12 (= G9), Q83 (= Q80), P86 (= P83), D87 (≠ E84), G88 (= G85), D111 (= D108), Y115 (= Y112), G116 (= G113), H117 (≠ S114), D118 (≠ G115), G219 (≠ S215), R220 (= R216), G221 (= G217), S252 (≠ G248), E256 (= E252), I257 (≠ V253), R260 (≠ H256)
1h5tA Thymidylyltransferase complexed with thymidylyldiphosphate-glucose (see paper)
65% identity, 98% coverage: 2:281/285 of query aligns to 4:284/290 of 1h5tA
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: L8 (= L6), G10 (= G8), Q82 (= Q80), P85 (= P83), G87 (= G85), L108 (= L106), D110 (= D108), Y145 (= Y142), G146 (= G143), E161 (= E158), K162 (= K159), V172 (= V169), R194 (= R191)
- binding thymidine-5'-diphosphate: Y114 (= Y112), G115 (= G113), H116 (≠ S114), D117 (≠ G115), R219 (= R216), G220 (= G217), V250 (≠ I247), S251 (≠ G248)
1h5rA Thymidylyltransferase complexed with thimidine and glucose-1-phospate (see paper)
65% identity, 98% coverage: 2:281/285 of query aligns to 4:284/290 of 1h5rA
- binding 1-O-phosphono-alpha-D-glucopyranose: L88 (= L86), Y145 (= Y142), G146 (= G143), E161 (= E158), K162 (= K159), V172 (= V169)
- binding thymidine: L8 (= L6), G10 (= G8), G11 (= G9), Q82 (= Q80), P85 (= P83), G87 (= G85), L88 (= L86), D110 (= D108), Y114 (= Y112), G115 (= G113), V250 (≠ I247), S251 (≠ G248), E255 (= E252), I256 (≠ V253)
4hocA Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-n- acetylglucosamine
65% identity, 100% coverage: 1:284/285 of query aligns to 1:283/286 of 4hocA
- binding uridine-diphosphate-n-acetylglucosamine: L6 (= L6), G8 (= G8), G9 (= G9), Q80 (= Q80), P83 (= P83), G85 (= G85), L86 (= L86), D108 (= D108), G144 (= G143), E159 (= E158), K160 (= K159), V170 (= V169)
3pkqA Q83d variant of s. Enterica rmla with dgtp (see paper)
64% identity, 98% coverage: 2:281/285 of query aligns to 3:280/285 of 3pkqA
- binding 2'-deoxyguanosine-5'-triphosphate: L7 (= L6), G9 (= G8), G10 (= G9), S11 (= S10), G12 (= G11), T13 (= T12), R14 (= R13), Q25 (= Q24), D81 (≠ Q80), S83 (≠ K82), L107 (= L106), G108 (= G107), D109 (= D108)
- binding magnesium ion: D109 (= D108), D221 (= D222)
4b2xB Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
64% identity, 100% coverage: 2:285/285 of query aligns to 13:297/302 of 4b2xB
4b5bA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
64% identity, 100% coverage: 2:285/285 of query aligns to 4:288/293 of 4b5bA
- binding N-(6-amino-1-benzyl-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)-N,3-dimethylbenzenesulfonamide: S41 (= S39), L45 (≠ M43), Y113 (≠ F111), G115 (= G113), V250 (≠ I247), A251 (≠ G248), E255 (= E252), I256 (≠ V253)
4b4gA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
64% identity, 100% coverage: 2:285/285 of query aligns to 4:288/293 of 4b4gA
- binding N-(6-amino-1-benzyl-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)-N-methylbutane-1-sulfonamide: L45 (≠ M43), Y113 (≠ F111), G115 (= G113), F118 (≠ L116), V250 (≠ I247), A251 (≠ G248), E255 (= E252), I256 (≠ V253), R259 (≠ H256)
4b42A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
64% identity, 100% coverage: 2:285/285 of query aligns to 4:288/293 of 4b42A
4b3uA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
64% identity, 100% coverage: 2:285/285 of query aligns to 10:294/299 of 4b3uA
Query Sequence
>Echvi_2361 FitnessBrowser__Cola:Echvi_2361
MKGIILAGGSGTRLYPLTIAVSKQLMPVYDKPMIYYPLSVLMMAGIREIMIITTPEDADA
FKKLLGDGSHLGCEFTFAIQPKPEGLAQAFVIGEEFIGDDKVALILGDNIFYGSGLQETL
LKHTDPEGGVVFAYHVNDPQRYGVVEFDQNKKAISIEEKPQAPKSNFAVPGLYFYDNRVV
EIAKQIKPSARGELEITDVNNAYLKEGKLSVGILSRGTAWLDTGTHQSLQQAGQFVEVIE
ERQGLKIGCVEEVAYHKGFITKQQLLAQAEKLGKSGYGTYLKGII
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory