SitesBLAST
Comparing Echvi_2380 FitnessBrowser__Cola:Echvi_2380 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4pfkA Phosphofructokinase. Structure and control (see paper)
51% identity, 98% coverage: 6:327/328 of query aligns to 1:318/319 of 4pfkA
- active site: G11 (= G16), R72 (= R77), C73 (≠ S78), D103 (= D108), G104 (= G109), G124 (= G130), T125 (= T131), D127 (= D133), D129 (= D135), R171 (= R177)
- binding adenosine-5'-diphosphate: S9 (= S14), Y41 (= Y46), R72 (= R77), C73 (≠ S78), F76 (= F81), K77 (≠ R82), G104 (= G109), G108 (= G113), R154 (= R160), G185 (≠ A191), R211 (≠ A217), G212 (≠ K218), K213 (= K219), H215 (≠ A221)
- binding 6-O-phosphono-beta-D-fructofuranose: D127 (= D133), M169 (= M175), E222 (= E228), H249 (= H258), R252 (= R261)
- binding magnesium ion: G185 (≠ A191), E187 (≠ A193)
3pfkA Phosphofructokinase. Structure and control (see paper)
51% identity, 98% coverage: 6:327/328 of query aligns to 1:318/319 of 3pfkA
- active site: G11 (= G16), R72 (= R77), C73 (≠ S78), D103 (= D108), G104 (= G109), G124 (= G130), T125 (= T131), D127 (= D133), D129 (= D135), R171 (= R177)
- binding phosphate ion: R154 (= R160), K213 (= K219), H249 (= H258), R252 (= R261)
6pfkA Phosphofructokinase, inhibited t-state (see paper)
51% identity, 98% coverage: 6:327/328 of query aligns to 1:318/319 of 6pfkA
- active site: G11 (= G16), R72 (= R77), C73 (≠ S78), D103 (= D108), G104 (= G109), G124 (= G130), T125 (= T131), D127 (= D133), D129 (= D135), R171 (= R177)
- binding 2-phosphoglycolic acid: R21 (= R26), R25 (= R30), G58 (≠ A63), D59 (≠ Y64), R154 (= R160), R211 (≠ A217), K213 (= K219)
P00512 ATP-dependent 6-phosphofructokinase; ATP-PFK; Phosphofructokinase; Phosphohexokinase; EC 2.7.1.11 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
51% identity, 98% coverage: 6:327/328 of query aligns to 1:318/319 of P00512
- RSVVR 21:25 (≠ RAVVR 26:30) binding
- D59 (≠ Y64) binding
- RC 72:73 (≠ RS 77:78) binding
- D103 (= D108) binding
- TID 125:127 (= TID 131:133) binding in other chain
- R154 (= R160) binding in other chain
- R162 (= R168) binding
- MGR 169:171 (= MGR 175:177) binding in other chain
- GAE 185:187 (≠ AAA 191:193) binding in other chain
- R211 (≠ A217) binding in other chain
- KKH 213:215 (≠ KQA 219:221) binding in other chain
- E222 (= E228) binding in other chain
- R243 (≠ K252) binding
- HVQR 249:252 (≠ HLQR 258:261) binding in other chain
1mtoA Crystal structure of a phosphofructokinase mutant from bacillus stearothermophilus bound with fructose-6-phosphate (see paper)
51% identity, 98% coverage: 6:327/328 of query aligns to 1:318/319 of 1mtoA
- active site: G11 (= G16), R72 (= R77), C73 (≠ S78), D103 (= D108), G104 (= G109), G124 (= G130), T125 (= T131), D127 (= D133), D129 (= D135), R171 (= R177)
- binding 6-O-phosphono-beta-D-fructofuranose: D127 (= D133), R162 (= R168), M169 (= M175), R171 (= R177), E222 (= E228), R243 (≠ K252), H249 (= H258), R252 (= R261)
4i4iA Crystal structure of bacillus stearothermophilus phosphofructokinase mutant t156a bound to pep (see paper)
50% identity, 98% coverage: 6:327/328 of query aligns to 1:318/319 of 4i4iA
- active site: G11 (= G16), R72 (= R77), C73 (≠ S78), D103 (= D108), G104 (= G109), G124 (= G130), T125 (= T131), D127 (= D133), D129 (= D135), R171 (= R177)
- binding phosphoenolpyruvate: R21 (= R26), R25 (= R30), G58 (≠ A63), R154 (= R160), R211 (≠ A217), K213 (= K219), H215 (≠ A221)
5xz9A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
50% identity, 98% coverage: 6:327/328 of query aligns to 1:321/321 of 5xz9A
- binding adenosine-5'-triphosphate: S9 (= S14), Y41 (= Y46), C73 (≠ S78), F76 (= F81), K77 (≠ R82), G102 (= G107), D103 (= D108), G104 (= G109), S105 (= S110), R107 (≠ T112), G108 (= G113)
5xzaA Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adp (see paper)
50% identity, 98% coverage: 6:327/328 of query aligns to 1:321/322 of 5xzaA
Q2FXM8 ATP-dependent 6-phosphofructokinase; ATP-PFK; Phosphofructokinase; Phosphohexokinase; EC 2.7.1.11 from Staphylococcus aureus (strain NCTC 8325 / PS 47) (see paper)
50% identity, 98% coverage: 6:327/328 of query aligns to 1:321/322 of Q2FXM8
- RC 72:73 (≠ RS 77:78) binding
- GDGS 102:105 (= GDGS 107:110) binding
- TID 127:129 (= TID 131:133) binding in other chain
- G150 (≠ E154) mutation to D: Exhibits higher affinity for fructose 6-phosphate and higher catalytic activity with a loss of dimer conversion; in association with A-151.
- L151 (≠ A155) mutation to A: Exhibits higher affinity for fructose 6-phosphate and higher catalytic activity with a loss of tetramer-dimer conversion; in association with D-150.
- R164 (= R168) mutation to A: Complete loss of fructose 6-phosphate binding.
- MGR 171:173 (= MGR 175:177) binding in other chain
- E224 (= E228) binding in other chain
- R245 (≠ K252) mutation to A: Complete loss of fructose 6-phosphate binding.
- HVQR 251:254 (≠ HLQR 258:261) binding in other chain
5xz6A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
53% identity, 91% coverage: 6:303/328 of query aligns to 1:296/318 of 5xz6A
5xz7A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
53% identity, 91% coverage: 6:303/328 of query aligns to 1:296/322 of 5xz7A
1pfkA Crystal structure of the complex of phosphofructokinase from escherichia coli with its reaction products (see paper)
47% identity, 96% coverage: 6:320/328 of query aligns to 2:312/320 of 1pfkA
- active site: G12 (= G16), R73 (= R77), F74 (≠ S78), D104 (= D108), G105 (= G109), G125 (= G130), T126 (= T131), D128 (= D133), D130 (= D135), R172 (= R177)
- binding adenosine-5'-diphosphate: G11 (= G15), R22 (= R26), R26 (= R30), Y56 (≠ S60), S59 (≠ A63), D60 (≠ Y64), R73 (= R77), F74 (≠ S78), F77 (= F81), R78 (= R82), G103 (= G107), D104 (= D108), G105 (= G109), S106 (= S110), M108 (≠ T112), G109 (= G113), R155 (= R160), G213 (≠ A217), K214 (= K218), H216 (≠ Q220)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: G12 (= G16), R73 (= R77), T126 (= T131), D128 (= D133), M170 (= M175), E223 (≠ A227), H250 (= H258), R253 (= R261)
- binding magnesium ion: G186 (≠ A191), E188 (≠ A193)
P0A796 ATP-dependent 6-phosphofructokinase isozyme 1; ATP-PFK 1; Phosphofructokinase 1; 6-phosphofructokinase isozyme I; Phosphohexokinase 1; Sedoheptulose-7-phosphate kinase; EC 2.7.1.11 from Escherichia coli (strain K12) (see 2 papers)
47% identity, 96% coverage: 6:320/328 of query aligns to 2:312/320 of P0A796
- G12 (= G16) binding
- RGVVR 22:26 (≠ RAVVR 26:30) binding
- RYSVSD 55:60 (≠ SSDIAY 59:64) binding
- RF 73:74 (≠ RS 77:78) binding
- GDGS 103:106 (= GDGS 107:110) binding
- D104 (= D108) binding
- TID 126:128 (= TID 131:133) binding in other chain
- D128 (= D133) active site, Proton acceptor; mutation to S: 18000-fold reduction of catalytic rate.
- R155 (= R160) binding in other chain
- R163 (= R168) binding
- R172 (= R177) mutation to S: 3.4-fold reduction in turnover numbers.
- GCE 186:188 (≠ AAA 191:193) binding in other chain
- KKH 214:216 (≠ KKQ 218:220) binding in other chain
- E223 (≠ A227) binding in other chain
- R244 (≠ K252) binding
- HIQR 250:253 (≠ HLQR 258:261) binding in other chain
4rh3A Amppcp-bound structure of human platelet phosphofructokinase in an r- state, crystal form ii (see paper)
42% identity, 97% coverage: 7:323/328 of query aligns to 1:355/731 of 4rh3A
- active site: G10 (= G16), R73 (= R77), C74 (≠ S78), D104 (= D108), G148 (= G130), S149 (≠ T131), D151 (= D133), D153 (= D135), R195 (= R177)
- binding phosphomethylphosphonic acid adenylate ester: G9 (= G15), R73 (= R77), C74 (≠ S78), F77 (= F81), R78 (= R82), G103 (= G107), D104 (= D108), G105 (= G109), S106 (= S110), G109 (= G113)
- binding phosphate ion: K240 (= K219)
Sites not aligning to the query:
4xykA Crystal structure of human phosphofructokinase-1 in complex with adp, northeast structural genomics consortium target hr9275 (see paper)
42% identity, 96% coverage: 9:323/328 of query aligns to 11:363/737 of 4xykA
- active site: G18 (= G16), R81 (= R77), C82 (≠ S78), D112 (= D108), G156 (= G130), S157 (≠ T131), D159 (= D133), D161 (= D135), R203 (= R177)
- binding adenosine-5'-diphosphate: Y48 (= Y46), R81 (= R77), C82 (≠ S78), R86 (= R82), G111 (= G107), D112 (= D108), G113 (= G109), S114 (= S110)
- binding phosphate ion: R28 (= R26), R32 (= R30), S67 (≠ A63), K248 (= K219)
Sites not aligning to the query:
Q01813 ATP-dependent 6-phosphofructokinase, platelet type; ATP-PFK; PFK-P; 6-phosphofructokinase type C; Phosphofructo-1-kinase isozyme C; PFK-C; Phosphohexokinase; EC 2.7.1.11 from Homo sapiens (Human) (see paper)
42% identity, 96% coverage: 9:323/328 of query aligns to 27:379/784 of Q01813
Sites not aligning to the query:
- 386 modified: Phosphoserine; S→A: Decreased interaction with ATG4B.
4xyjA Crystal structure of human phosphofructokinase-1 in complex with atp and mg, northeast structural genomics consortium target hr9275 (see paper)
42% identity, 96% coverage: 9:323/328 of query aligns to 15:367/768 of 4xyjA
- active site: G22 (= G16), R85 (= R77), C86 (≠ S78), D116 (= D108), G160 (= G130), S161 (≠ T131), D163 (= D133), D165 (= D135), R207 (= R177)
- binding adenosine-5'-triphosphate: G21 (= G15), G22 (= G16), Y52 (= Y46), C86 (≠ S78), F89 (= F81), R90 (= R82), G115 (= G107), D116 (= D108), G117 (= G109), S118 (= S110), G121 (= G113), S161 (≠ T131), R207 (= R177)
- binding magnesium ion: G21 (= G15), G22 (= G16), D116 (= D108), D165 (= D135)
- binding phosphate ion: R32 (= R26), R36 (= R30), S72 (≠ Y64), G221 (≠ A191), K252 (= K219)
Sites not aligning to the query:
4xyjF Crystal structure of human phosphofructokinase-1 in complex with atp and mg, northeast structural genomics consortium target hr9275 (see paper)
42% identity, 96% coverage: 9:323/328 of query aligns to 13:365/761 of 4xyjF
- active site: G20 (= G16), R83 (= R77), C84 (≠ S78), D114 (= D108), G158 (= G130), S159 (≠ T131), D161 (= D133), D163 (= D135), R205 (= R177)
- binding adenosine-5'-triphosphate: G20 (= G16), Y50 (= Y46), R83 (= R77), C84 (≠ S78), F87 (= F81), R88 (= R82), G113 (= G107), D114 (= D108), G115 (= G109), S116 (= S110), G119 (= G113), S159 (≠ T131)
- binding magnesium ion: G19 (= G15), G20 (= G16), G112 (= G106), D114 (= D108), G158 (= G130), D163 (= D135), R205 (= R177)
- binding phosphate ion: R30 (= R26), R34 (= R30), S69 (≠ A63), S70 (≠ Y64), G219 (≠ A191), K250 (= K219)
Sites not aligning to the query:
P47859 ATP-dependent 6-phosphofructokinase, platelet type; ATP-PFK; PFK-P; 6-phosphofructokinase type C; Phosphofructo-1-kinase isozyme C; PFK-C; Phosphohexokinase; EC 2.7.1.11 from Oryctolagus cuniculus (Rabbit) (see paper)
42% identity, 96% coverage: 9:323/328 of query aligns to 27:379/791 of P47859
Sites not aligning to the query:
- 12 modified: Phosphoserine; by PKA
P17858 ATP-dependent 6-phosphofructokinase, liver type; ATP-PFK; PFK-L; 6-phosphofructokinase type B; Phosphofructo-1-kinase isozyme B; PFK-B; Phosphohexokinase; EC 2.7.1.11 from Homo sapiens (Human) (see 3 papers)
41% identity, 94% coverage: 9:317/328 of query aligns to 18:369/780 of P17858
- G81 (= G70) natural variant: G -> A
- R151 (vs. gap) to W: in dbSNP:rs755851304
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 527 T→A: Does not affect GlcNAcylation.
- 529 modified: carbohydrate, O-linked (GlcNAc) serine; S→A: Prevents GlcNAcylation and enhance enzyme activity.
Query Sequence
>Echvi_2380 FitnessBrowser__Cola:Echvi_2380
MESKAITKIGVLTSGGDAPGMNAAIRAVVRCAFYYNLEVYGIYRGYEGMIQNDIRQLNSS
DIAYVLERGGTFLKSARSAEFRTPEGRKKAYENLQQHGINGLVVIGGDGSLTGAHLFYKE
FGIPAIGLPGTIDNDLSGTDNTIGFDTACNTAIEAIDKIRDTATSHDRLFFVEVMGRDSG
FIAINAGIGSAAAATLIPEKKMPVEALIDRLNTRAKAKKQANVVIVAEGGKSGGALEISK
KVKKYLPNYDIKVTILGHLQRGGSPTSYDRVLASKLGVSAVEGLMQGKCDVMAGVINNKV
VYTPIKRAIVDDKEVDEEDFRVAKILST
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory