Comparing Echvi_2395 FitnessBrowser__Cola:Echvi_2395 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9X1K8 4-hydroxy-tetrahydrodipicolinate reductase; HTPA reductase; EC 1.17.1.8 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
34% identity, 99% coverage: 1:238/240 of query aligns to 1:212/216 of Q9X1K8
1vm6B Crystal structure of dihydrodipicolinate reductase (tm1520) from thermotoga maritima at 2.27 a resolution
34% identity, 99% coverage: 1:238/240 of query aligns to 6:217/218 of 1vm6B
4ywjA Crystal structure of 4-hydroxy-tetrahydrodipicolinate reductase (htpa reductase) from pseudomonas aeruginosa
31% identity, 81% coverage: 47:240/240 of query aligns to 71:267/268 of 4ywjA
Sites not aligning to the query:
1arzB Escherichia coli dihydrodipicolinate reductase in complex with nadh and 2,6 pyridine dicarboxylate (see paper)
32% identity, 83% coverage: 41:238/240 of query aligns to 62:264/269 of 1arzB
Sites not aligning to the query:
P04036 4-hydroxy-tetrahydrodipicolinate reductase; HTPA reductase; EC 1.17.1.8 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 83% coverage: 41:238/240 of query aligns to 66:268/273 of P04036
Sites not aligning to the query:
1drvA Escherichia coli dhpr/acnadh complex (see paper)
32% identity, 83% coverage: 41:238/240 of query aligns to 63:265/270 of 1drvA
Sites not aligning to the query:
1druA Escherichia coli dhpr/nadh complex (see paper)
32% identity, 83% coverage: 41:238/240 of query aligns to 63:265/270 of 1druA
Sites not aligning to the query:
1arzA Escherichia coli dihydrodipicolinate reductase in complex with nadh and 2,6 pyridine dicarboxylate (see paper)
32% identity, 83% coverage: 41:238/240 of query aligns to 63:265/270 of 1arzA
1drwA Escherichia coli dhpr/nhdh complex (see paper)
32% identity, 83% coverage: 41:238/240 of query aligns to 65:267/272 of 1drwA
Sites not aligning to the query:
1dihA Three-dimensional structure of e. Coli dihydrodipicolinate reductase (see paper)
32% identity, 83% coverage: 41:238/240 of query aligns to 65:267/272 of 1dihA
Sites not aligning to the query:
5tejB Structure of 4-hydroxy-tetrahydrodipicolinate reductase from vibrio vulnificus with 2,5 furan dicarboxylic and nadh (see paper)
31% identity, 81% coverage: 45:238/240 of query aligns to 68:264/269 of 5tejB
Sites not aligning to the query:
5tejA Structure of 4-hydroxy-tetrahydrodipicolinate reductase from vibrio vulnificus with 2,5 furan dicarboxylic and nadh (see paper)
31% identity, 81% coverage: 45:238/240 of query aligns to 68:264/269 of 5tejA
Sites not aligning to the query:
5temA Structure of 4-hydroxy-tetrahydrodipicolinate reductase from vibrio vulnificus with 2,6 pyridine dicarboxylic and nadh (see paper)
31% identity, 81% coverage: 45:238/240 of query aligns to 68:264/266 of 5temA
Sites not aligning to the query:
3ijpB Crystal structure of dihydrodipicolinate reductase from bartonella henselae at 2.0a resolution (see paper)
28% identity, 81% coverage: 44:238/240 of query aligns to 67:264/267 of 3ijpB
Sites not aligning to the query:
3ijpA Crystal structure of dihydrodipicolinate reductase from bartonella henselae at 2.0a resolution (see paper)
28% identity, 81% coverage: 44:238/240 of query aligns to 67:264/266 of 3ijpA
Sites not aligning to the query:
5eesA Crystal structure of dapb in complex with NADP+ from corynebacterium glutamicum (see paper)
26% identity, 90% coverage: 23:238/240 of query aligns to 14:245/247 of 5eesA
Sites not aligning to the query:
5eerA Crystal structure of dapb from corynebacterium glutamicum (see paper)
26% identity, 90% coverage: 23:238/240 of query aligns to 14:245/247 of 5eerA
P9WP23 4-hydroxy-tetrahydrodipicolinate reductase; HTPA reductase; EC 1.17.1.8 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
25% identity, 96% coverage: 1:231/240 of query aligns to 1:234/245 of P9WP23
1p9lA Structure of m. Tuberculosis dihydrodipicolinate reductase in complex with nadh and 2,6 pdc (see paper)
25% identity, 96% coverage: 1:231/240 of query aligns to 1:234/245 of 1p9lA
1c3vA Dihydrodipicolinate reductase from mycobacterium tuberculosis complexed with NADPH and pdc (see paper)
25% identity, 96% coverage: 1:231/240 of query aligns to 1:234/245 of 1c3vA
>Echvi_2395 FitnessBrowser__Cola:Echvi_2395
MNILILGYGKMGKIISQIAEERGHTIAAKIDESNIHELDKLDTTKVDAAIEFSQPDAAVQ
NLSWAIKHNIPVVCGTTGWLDKKPEIERLTLSNGGAFFYASNYSIGVNILFKVNSFLAKI
MNEQPAYTVKMEEIHHTEKKDAPSGTAITLAESIIDRVDRVKRWDLDKDVNGNEHSLPIT
AKRIDPAPGTHIVTYQSEIDDIEIKHTAHSRKGFALGAVLVAEWIKDKKGVLSMDDYLTF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory