Comparing Echvi_2460 Echvi_2460 ATP phosphoribosyltransferase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4yb7A Adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with atp (see paper)
48% identity, 98% coverage: 5:285/286 of query aligns to 4:295/296 of 4yb7A
4yb6A Adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with the inhibitors amp and histidine (see paper)
48% identity, 98% coverage: 5:285/286 of query aligns to 4:295/296 of 4yb6A
4yb7C Adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with atp (see paper)
48% identity, 98% coverage: 5:285/286 of query aligns to 4:293/294 of 4yb7C
4yb6E Adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with the inhibitors amp and histidine (see paper)
48% identity, 98% coverage: 5:285/286 of query aligns to 4:292/293 of 4yb6E
1q1kA Structure of atp-phosphoribosyltransferase from e. Coli complexed with pr-atp (see paper)
48% identity, 98% coverage: 5:285/286 of query aligns to 3:287/288 of 1q1kA
1h3dA Structure of the e.Coli atp-phosphoribosyltransferase (see paper)
48% identity, 98% coverage: 5:285/286 of query aligns to 3:287/288 of 1h3dA
7dahC Adenosine triphosphate phosphoribosyltransferase from vibrio cholerae in complex with atp and prpp
47% identity, 98% coverage: 5:285/286 of query aligns to 4:287/288 of 7dahC
5ubgA Catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni with bound phosphoribosyl-atp (see paper)
46% identity, 73% coverage: 5:212/286 of query aligns to 4:221/222 of 5ubgA
5ubiA Catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni with bound prpp (see paper)
47% identity, 71% coverage: 5:208/286 of query aligns to 4:217/218 of 5ubiA
5ub9A Catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni (see paper)
46% identity, 73% coverage: 5:212/286 of query aligns to 3:219/220 of 5ub9A
2vd3A The structure of histidine inhibited hisg from methanobacterium thermoautotrophicum
38% identity, 98% coverage: 5:285/286 of query aligns to 5:288/289 of 2vd3A
5lhtA Atp phosphoribosyltransferase from mycobacterium tuberculosis in complex with the allosteric activator 3-(2-thienyl)-l-alanine (see paper)
30% identity, 98% coverage: 4:282/286 of query aligns to 1:280/284 of 5lhtA
1nh8A Atp phosphoribosyltransferase (atp-prtase) from mycobacterium tuberculosis in complex with amp and histidine (see paper)
30% identity, 98% coverage: 4:282/286 of query aligns to 1:272/276 of 1nh8A
5u99A Transition state analysis of adenosine triphosphate phosphoribosyltransferase (see paper)
29% identity, 98% coverage: 4:282/286 of query aligns to 3:274/278 of 5u99A
6czmE Crystal structure of medicago truncatula atp-phosphoribosyltransferase in tense form (see paper)
27% identity, 97% coverage: 5:281/286 of query aligns to 10:323/342 of 6czmE
6fd9A Catalytic subunit hisg from psychrobacter arcticus atp phosphoribosyltransferase (hiszg atpprt) in complex with amp
30% identity, 66% coverage: 13:202/286 of query aligns to 11:200/209 of 6fd9A
6fcwA Catalytic subunit hisg from psychrobacter arcticus atp phosphoribosyltransferase (hiszg atpprt) in complex with pratp
30% identity, 66% coverage: 13:202/286 of query aligns to 11:200/209 of 6fcwA
6fctA Catalytic subunit hisg from psychrobacter arcticus atp phosphoribosyltransferase (hiszg atpprt) in complex with prpp and atp
30% identity, 66% coverage: 13:202/286 of query aligns to 11:200/209 of 6fctA
6fcaA Catalytic subunit hisg from psychrobacter arcticus atp phosphoribosyltransferase (hiszg atpprt) in complex with prpp
30% identity, 66% coverage: 13:202/286 of query aligns to 11:200/209 of 6fcaA
6fcyA Catalytic subunit hisg from psychrobacter arcticus atp phosphoribosyltransferase (hiszg atpprt) in complex with prpp and adp
30% identity, 66% coverage: 13:202/286 of query aligns to 11:200/208 of 6fcyA
>Echvi_2460 Echvi_2460 ATP phosphoribosyltransferase
MENIIRIAVQKSGRLSEDSLSLIKECGIKFYNGTGKLKSTSTNFPIEFLYLRDDDIPGYV
ADGVADLGIVGENELVEKDKSVDVLKKLGFSKCRLSLAIPKSQEYPGLSYFEGKNIATSY
TKILGDYLKANHINAEIHEISGSVEIAPSIGLAEGICDIVSSGSTLMMNGLKEVEEIFKS
EAVLISHKGLNSEKMAIVEKLLFRINAVQTGKSNKYVLLNAPNESLDKIISLIPGMRSPT
ILPLAQEGWSSVHSVLSEDQFWENIEELRAAGAEGILVVPIEKMVI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory