Comparing Echvi_2491 FitnessBrowser__Cola:Echvi_2491 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3u48B From soil to structure: a novel dimeric family 3-beta-glucosidase isolated from compost using metagenomic analysis
72% identity, 95% coverage: 34:764/766 of query aligns to 3:734/742 of 3u48B
5tf0A Crystal structure of glycosil hydrolase family 3 n-terminal domain protein from bacteroides intestinalis
64% identity, 94% coverage: 38:759/766 of query aligns to 8:728/733 of 5tf0A
5xxmA Crystal structure of gh3 beta-glucosidase from bacteroides thetaiotaomicron in complex with gluconolactone (see paper)
64% identity, 95% coverage: 38:761/766 of query aligns to 10:743/749 of 5xxmA
5xxnA Crystal structure of mutant (d286n) beta-glucosidase from bacteroides thetaiotaomicron in complex with sophorose (see paper)
63% identity, 95% coverage: 38:761/766 of query aligns to 7:732/744 of 5xxnA
6r5vA The crystal structure of glycoside hydrolase bglx inactive mutant d286n from p. Aeruginosa in complex with xylotriose (see paper)
49% identity, 94% coverage: 39:759/766 of query aligns to 9:724/730 of 6r5vA
6r5oA The crystal structure the glycoside hydrolase bglx inactive mutant d286n from p. Aeruginosa in complex with two glucose molecules (see paper)
49% identity, 94% coverage: 39:759/766 of query aligns to 9:724/730 of 6r5oA
6r5nA The crystal structure of glycoside hydrolase bglx from p. Aeruginosa in complex with 1-deoxynojirimycin (see paper)
49% identity, 94% coverage: 39:759/766 of query aligns to 9:727/733 of 6r5nA
6r5iA The crystal structure of the glycoside hydrolase bglx from p. Aeruginosa (see paper)
49% identity, 94% coverage: 39:759/766 of query aligns to 9:727/733 of 6r5iA
6r5tA The crystal structure of glycoside hydrolase bglx inactive mutant d286n from p. Aeruginosa in complex with lactose (see paper)
49% identity, 94% coverage: 39:759/766 of query aligns to 9:727/733 of 6r5tA
4zoaA Crystal structure of beta-glucosidase from listeria innocua in complex with isofagomine (see paper)
43% identity, 95% coverage: 35:762/766 of query aligns to 4:709/716 of 4zoaA
4zobA Crystal structure of beta-glucosidase from listeria innocua in complex with gluconolactone (see paper)
43% identity, 95% coverage: 35:762/766 of query aligns to 4:715/722 of 4zobA
4zo7A Crystal structure of mutant (d270a) beta-glucosidase from listeria innocua in complex with gentiobiose (see paper)
43% identity, 95% coverage: 35:762/766 of query aligns to 4:717/724 of 4zo7A
4zo6B Crystal structure of mutant (d270a) beta-glucosidase from listeria innocua in complex with cellobiose (see paper)
43% identity, 95% coverage: 35:762/766 of query aligns to 4:717/724 of 4zo6B
7zdyW Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside
36% identity, 95% coverage: 30:757/766 of query aligns to 8:733/763 of 7zdyW
7zb3A Crystal structure of beta-xylosidase from thermotoga maritima in complex with xylohexaose hydrolysed to xylobiose
36% identity, 95% coverage: 30:757/766 of query aligns to 8:733/765 of 7zb3A
7zgzX Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside hydrolysed to xylose
36% identity, 95% coverage: 30:757/766 of query aligns to 8:722/753 of 7zgzX
8c7fA Crystal structure of beta-xylosidase mutant (d281n, e517q) from thermotoga maritima in complex with xylopentaose
36% identity, 95% coverage: 30:757/766 of query aligns to 8:742/772 of 8c7fA
5z9sA Functional and structural characterization of a beta-glucosidase involved in saponin metabolism from intestinal bacteria (see paper)
36% identity, 94% coverage: 35:755/766 of query aligns to 3:753/765 of 5z9sA
5z87A Structural of a novel b-glucosidase emgh1 at 2.3 angstrom from erythrobacter marinus
35% identity, 94% coverage: 44:762/766 of query aligns to 25:753/756 of 5z87A
8xrvA The crystal structure of a gh3 enzyme ccbgl3b with glucose (see paper)
34% identity, 96% coverage: 32:764/766 of query aligns to 10:746/749 of 8xrvA
>Echvi_2491 FitnessBrowser__Cola:Echvi_2491
MKKYILFLMAIGGLMMAFKPSGKTPPPHHTDPYTQKADSVLALMTLEEKIGQLNLPAAGD
FTTGQASSSNIAEKIKAGKVGGLFNIKTVQKIRDVQRVAVEESRLGIPLLFGMDVIHGYE
TIFPIPLGLSSTWDMELIKKSAQLAAKEASADGINWTFSPMTDISRDPRWGRVSEGSGED
PYLGAQIAKAMVEGYQGDDLSLSHTLMACVKHFALYGAPEAGRDYNTVDMSRQRMYNEYF
PPYKAAVDAGVGTVMTAFNEVEGIPASANKWLMTEVLRNQWGFDGFVVTDYTAINEMTAH
GIGDLKTVSAKALKAGVDMDMVGEGFLSTLKASLEEGTITETQIDEACRRILVAKFKLGL
FEDPYRYCDAERAETEIFNAENRQLSREIAAQSFVLMKNEGQVLPLKKTGTIALIGPMAD
NAENMTGTWSVAGRFKESISLKQGIQHAVGDQVKIIEARGANIVADSLLESRVSVFGKPT
YRDQRPEEELIEEALEAAKAADVIVAAMGESAEMSGESSSRSTIELPENQRRLLKALAKT
GKPVVMVLFSGRPLAIQWEAEHIPSILNVWFGGSEAGDAIADVLFGEVNPSGKLTMTFPQ
NTGQIPLYYNHKNTGRPLPEGQWFQKFRSNFLDVPNAPLFPFGYGLSYTEFDYGDITLST
EKLSGHQTLYATITLTNAGRFDGKEVVQLYVRDMVGSMTRPVKELKGFQKVFLKAGETKE
VTFELTQEDLKFYNHDLDFVFEPGEFEIMIGTNSHDVSSMKVNWEE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory