SitesBLAST
Comparing Echvi_2510 FitnessBrowser__Cola:Echvi_2510 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ey5B Lbcats
61% identity, 96% coverage: 8:385/392 of query aligns to 1:380/383 of 5ey5B
- binding pyridoxal-5'-phosphate: H81 (= H87), K82 (= K88), Q109 (= Q115), S185 (= S191), G227 (= G234), G229 (= G236), S230 (= S237), N231 (= N238), E345 (= E352), S371 (= S376), G372 (= G377)
8egzB Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate
59% identity, 97% coverage: 7:387/392 of query aligns to 1:378/386 of 8egzB
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H87), K82 (= K88), T105 (= T111), G106 (= G112), A107 (= A113), Q109 (= Q115), H110 (= H116), S185 (= S191), G229 (= G236), S230 (= S237), N231 (= N238), G297 (= G305), E344 (= E352), S367 (= S376)
8eh1A Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate and complexed with 4-hydroxyquinoline
59% identity, 97% coverage: 8:387/392 of query aligns to 1:377/383 of 8eh1A
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H80 (= H87), K81 (= K88), T104 (= T111), G105 (= G112), A106 (= A113), Q108 (= Q115), H109 (= H116), S184 (= S191), G228 (= G236), S229 (= S237), N230 (= N238), G296 (= G305), E343 (= E352), S366 (= S376)
- binding quinolin-4-ol: G103 (≠ E110), L160 (= L167), I164 (≠ T171), G183 (= G190), S184 (= S191), Y299 (= Y308)
8eh0A Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate and complexed with quinoline n-oxide
59% identity, 97% coverage: 8:387/392 of query aligns to 1:377/385 of 8eh0A
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H80 (= H87), K81 (= K88), T104 (= T111), G105 (= G112), A106 (= A113), Q108 (= Q115), H109 (= H116), S184 (= S191), G228 (= G236), S229 (= S237), N230 (= N238), G296 (= G305), E343 (= E352), S366 (= S376), G367 (= G377)
- binding 1-oxo-1lambda~5~-quinoline: L160 (= L167), I164 (≠ T171), Y180 (= Y187), P182 (≠ I189), G183 (= G190), S184 (= S191), V186 (= V193), Y299 (= Y308)
8egyA Engineered holo tyrosine synthase (tmtyrs1) derived from t. Maritima trpb
59% identity, 97% coverage: 8:387/392 of query aligns to 1:377/385 of 8egyA
5t6mB Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
56% identity, 98% coverage: 9:391/392 of query aligns to 2:386/386 of 5t6mB
1v8zA X-ray crystal structure of the tryptophan synthase b2 subunit from hyperthermophile, pyrococcus furiosus (see paper)
56% identity, 98% coverage: 9:391/392 of query aligns to 2:386/386 of 1v8zA
- active site: K82 (= K88), E104 (= E110), S371 (= S376)
- binding pyridoxal-5'-phosphate: H81 (= H87), K82 (= K88), Q109 (= Q115), S185 (= S191), G227 (= G234), G228 (= G235), G229 (= G236), S230 (= S237), N231 (= N238), E345 (= E352), S371 (= S376), G372 (= G377)
5dw0A Trpb from pyrococcus furiosus with l-serine bound as the external aldimine (see paper)
56% identity, 98% coverage: 9:391/392 of query aligns to 2:386/388 of 5dw0A
- active site: K82 (= K88), E104 (= E110), S371 (= S376)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H81 (= H87), K82 (= K88), T105 (= T111), G106 (= G112), A107 (= A113), Q109 (= Q115), H110 (= H116), S185 (= S191), G227 (= G234), G229 (= G236), S230 (= S237), N231 (= N238), G298 (= G305), D300 (= D307), E345 (= E352), S371 (= S376)
6am8B Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9 with trp bound as e(aex2) (see paper)
57% identity, 97% coverage: 9:388/392 of query aligns to 2:383/385 of 6am8B
- active site: K82 (= K88), E104 (= E110), S371 (= S376)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-l-tryptophane: H81 (= H87), K82 (= K88), E104 (= E110), T105 (= T111), G106 (= G112), A107 (= A113), Q109 (= Q115), H110 (= H116), L161 (= L167), S185 (= S191), V187 (= V193), G227 (= G234), G228 (= G235), G229 (= G236), S230 (= S237), N231 (= N238), G298 (= G305), Y301 (= Y308), E345 (= E352), S371 (= S376), G372 (= G377)
- binding tryptophan: P12 (= P19), L169 (= L175), S274 (≠ L281), H275 (= H282)
7rnpA Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound (see paper)
56% identity, 97% coverage: 9:388/392 of query aligns to 2:383/384 of 7rnpA
5ocwB Structure of mycobacterium tuberculosis tryptophan synthase in space group f222 (see paper)
54% identity, 99% coverage: 5:391/392 of query aligns to 6:397/399 of 5ocwB
- active site: K93 (= K88), E115 (= E110), S382 (= S376)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H92 (= H87), K93 (= K88), T116 (= T111), G117 (= G112), A118 (= A113), Q120 (= Q115), H121 (= H116), T196 (≠ S191), G238 (= G234), G240 (= G236), S241 (= S237), N242 (= N238), G309 (= G305), E356 (= E352), S382 (= S376)
6u6cB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk2-bound form (see paper)
54% identity, 99% coverage: 5:391/392 of query aligns to 11:402/405 of 6u6cB
- active site: K98 (= K88), E120 (= E110), S387 (= S376)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H97 (= H87), K98 (= K88), T121 (= T111), G122 (= G112), A123 (= A113), Q125 (= Q115), H126 (= H116), T201 (≠ S191), G243 (= G234), G245 (= G236), S246 (= S237), N247 (= N238), G314 (= G305), E361 (= E352), S387 (= S376)
- binding 1-(2-fluorobenzene-1-carbonyl)-N-methyl-2,3-dihydro-1H-indole-5-sulfonamide: Y26 (= Y17), F185 (≠ L175), W188 (= W178), Y197 (= Y187), F199 (≠ I189), G204 (= G194), P205 (= P195), H291 (= H282), G292 (= G283)
6usaB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk1-bound form (see paper)
54% identity, 99% coverage: 5:391/392 of query aligns to 10:401/404 of 6usaB
- active site: K97 (= K88), E119 (= E110), S386 (= S376)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H87), K97 (= K88), T120 (= T111), G121 (= G112), A122 (= A113), G123 (= G114), Q124 (= Q115), H125 (= H116), T200 (≠ S191), G242 (= G234), G244 (= G236), S245 (= S237), N246 (= N238), G313 (= G305), E360 (= E352), S386 (= S376)
- binding (3R,4R)-4-[4-(2-Chlorophenyl)piperazin-1-yl]-1,1-dioxothiolan-3-ol: F184 (≠ L175), W187 (= W178), Y196 (= Y187), F198 (≠ I189), G203 (= G194), P204 (= P195), F207 (≠ Y198), H290 (= H282), G291 (= G283)
6uapB Crystal structure of tryptophan synthase from m. Tuberculosis - open form with brd6309 bound
54% identity, 99% coverage: 5:391/392 of query aligns to 10:401/405 of 6uapB
- active site: K97 (= K88), E119 (= E110), S386 (= S376)
- binding (2R,3S,4R)-3-(4'-chloro-2',6'-difluoro[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: I180 (≠ T171), N181 (= N172), F184 (≠ L175), Y196 (= Y187), F198 (≠ I189), P204 (= P195), F207 (≠ Y198), H290 (= H282)
6dweB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and brd0059-bound form
54% identity, 99% coverage: 5:391/392 of query aligns to 10:401/404 of 6dweB
- active site: K97 (= K88), E119 (= E110), S386 (= S376)
- binding (2R,3S,4R)-3-(2',6'-difluoro-4'-methyl[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: F184 (≠ L175), Y196 (= Y187), F198 (≠ I189), P204 (= P195), F207 (≠ Y198), H290 (= H282)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H87), K97 (= K88), T120 (= T111), G121 (= G112), A122 (= A113), G123 (= G114), Q124 (= Q115), H125 (= H116), T200 (≠ S191), G242 (= G234), G244 (= G236), S245 (= S237), N246 (= N238), G313 (= G305), E360 (= E352), S386 (= S376)
5tciH Crystal structure of tryptophan synthase from m. Tuberculosis - brd4592-bound form (see paper)
54% identity, 99% coverage: 5:391/392 of query aligns to 11:402/406 of 5tciH
- active site: K98 (= K88), E120 (= E110), S387 (= S376)
- binding (2R,3S,4R)-3-(2'-fluoro[1,1'-biphenyl]-4-yl)-4-(hydroxymethyl)azetidine-2-carbonitrile: P28 (= P19), L31 (= L22), Y197 (= Y187), F199 (≠ I189), P205 (= P195), F208 (≠ Y198), H291 (= H282)
5ixjD Tryptophan synthase beta-subunit from pyrococcus furiosus with l- threonine non-covalently bound in the active site (see paper)
56% identity, 98% coverage: 9:391/392 of query aligns to 2:384/394 of 5ixjD
5t6mA Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
57% identity, 97% coverage: 9:388/392 of query aligns to 2:381/383 of 5t6mA
5vm5D Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9, with ser bound (see paper)
57% identity, 97% coverage: 9:388/392 of query aligns to 2:381/383 of 5vm5D
- active site: K82 (= K88), E104 (= E110), S369 (= S376)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H87), K82 (= K88), T105 (= T111), G106 (= G112), A107 (= A113), Q109 (= Q115), H110 (= H116), S185 (= S191), G227 (= G234), G229 (= G236), S230 (= S237), N231 (= N238), G296 (= G305), E343 (= E352), S369 (= S376)
5dw3A Tryptophan synthase beta-subunit from pyrococcus furiosus with product l-tryptophan non-covalently bound in the active site (see paper)
57% identity, 97% coverage: 9:388/392 of query aligns to 2:382/383 of 5dw3A
- active site: K82 (= K88), E104 (= E110), S370 (= S376)
- binding tryptophan: K82 (= K88), E104 (= E110), T105 (= T111), G106 (= G112), A107 (= A113), Q109 (= Q115), H110 (= H116), S185 (= S191), G228 (= G235), Y300 (= Y308)
Query Sequence
>Echvi_2510 FitnessBrowser__Cola:Echvi_2510
MVKVDEKGFYGKFGGAYIPEMLYPNVEELRTNYEKITESDEFKDEFHALLKDYVGRPTPL
YYAKRLSQEYGAKIYLKREDLCHTGAHKVNNTIGQIILAKKLGKKRIIAETGAGQHGVAT
ATVCALMGMDCTVYMGAIDMERQKPNVERMRILGAKVVPATSGSQTLKDATNEALRQWIN
NPVDTHYIIGSVVGPHPYPEMVARFQSVISEEIKYQLKEKEGKEDPDMVIACVGGGSNAA
GAFYHYYNTPSVRLVAVEAAGLGVASGKSAATTALGTPGVLHGSKTLLMQTEDGQVVEPH
SISAGLDYPGIGPVHAHLFDSKRGEFYAVEDEDAMKAGVELSRLEGIIPAIESAHALSVL
KQLKFKPSDVIVINLSGRGDKDLDTYIKWGGY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory