Comparing Echvi_2517 FitnessBrowser__Cola:Echvi_2517 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
6j2lA Crystal structure of bi-functional enzyme (see paper)
54% identity, 86% coverage: 5:176/201 of query aligns to 8:178/200 of 6j2lA
6j2lB Crystal structure of bi-functional enzyme (see paper)
51% identity, 86% coverage: 5:176/201 of query aligns to 7:163/185 of 6j2lB
7bgnA Crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
41% identity, 93% coverage: 13:198/201 of query aligns to 15:203/204 of 7bgnA
Sites not aligning to the query:
7bgmA Crystal structure of mthisn2, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
40% identity, 93% coverage: 13:198/201 of query aligns to 17:212/213 of 7bgmA
>Echvi_2517 FitnessBrowser__Cola:Echvi_2517
MENLKIDFDKVNGLVPAIIQDATTNAVLMLGYMNEEALQKTQESGKVTFFSRTKQRLWTK
GETSGNFMHVQSIKVDCDNDTLLIKADPVGPVCHTGADTCFDEKNTSKTAFIDQLRSIIK
DRKNNPTDKSYTASLFAKGINKVAQKVGEEAVEIVIEAKDDHKDLFMGEAADLLFHYLVL
LEAKGYELDEVMDVLIQRHKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory