Comparing Echvi_2634 FitnessBrowser__Cola:Echvi_2634 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
36% identity, 93% coverage: 14:263/268 of query aligns to 5:253/367 of P0A7B5
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
35% identity, 93% coverage: 14:263/268 of query aligns to 3:251/365 of 2j5tD
Sites not aligning to the query:
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
32% identity, 95% coverage: 14:267/268 of query aligns to 13:258/258 of 7wx3B
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
32% identity, 95% coverage: 14:267/268 of query aligns to 13:236/236 of 7f5xA
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
32% identity, 87% coverage: 14:246/268 of query aligns to 1:219/241 of 2akoA
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
31% identity, 93% coverage: 14:263/268 of query aligns to 3:211/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
30% identity, 93% coverage: 14:263/268 of query aligns to 3:209/323 of 2j5vA
8u0mA Isopentenyl phosphate kinase (see paper)
26% identity, 49% coverage: 134:265/268 of query aligns to 123:243/247 of 8u0mA
Sites not aligning to the query:
8u0nA Isopentenyl phosphate kinase (see paper)
26% identity, 49% coverage: 134:265/268 of query aligns to 122:241/245 of 8u0nA
Sites not aligning to the query:
8u0mB Isopentenyl phosphate kinase (see paper)
26% identity, 49% coverage: 134:265/268 of query aligns to 124:243/247 of 8u0mB
Sites not aligning to the query:
8u0lA Isopentenyl phosphate kinase (see paper)
26% identity, 49% coverage: 134:265/268 of query aligns to 124:243/247 of 8u0lA
Sites not aligning to the query:
8u0kA Isopentenyl phosphate kinase (see paper)
26% identity, 49% coverage: 134:265/268 of query aligns to 124:243/247 of 8u0kA
Sites not aligning to the query:
3wwmA Crystal structure of lysz from thermus thermophilus with adp (see paper)
28% identity, 47% coverage: 134:259/268 of query aligns to 146:264/269 of 3wwmA
Sites not aligning to the query:
O50147 [LysW]-aminoadipate kinase; EC 2.7.2.17 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
28% identity, 47% coverage: 134:259/268 of query aligns to 146:264/269 of O50147
Sites not aligning to the query:
7lntB Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to benzyl monophosphate and atp (see paper)
23% identity, 40% coverage: 160:266/268 of query aligns to 152:256/260 of 7lntB
Sites not aligning to the query:
7lnuB Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to isopentenyl monophosphate and atp (see paper)
23% identity, 40% coverage: 160:266/268 of query aligns to 153:257/261 of 7lnuB
Sites not aligning to the query:
>Echvi_2634 FitnessBrowser__Cola:Echvi_2634
MEKNTKMDNNEGPKRIVIKVGTNVMTNRDNRIVNTVLRKMVDQIAILYERGIMSVLVSSG
SVIAGKEVLGSKVGIKDKIIRRQVFSAVGQPRMMRHYYNIFQDYGMRCAQVLATKRDFDP
GKHRENMINCYEGLLSEGIIPIANEDDAVSLSMSTFTDNDELASLVAELTKADMLILLTD
TDGLYNGHPDDENTERIAHVGTDEKVEHFIQESTKGEAEGRGGMKSKLNVAKEAARKNIP
TYIANGNVDNMILDIVDGKEVGTKVSDD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory