Comparing Echvi_2704 FitnessBrowser__Cola:Echvi_2704 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
36% identity, 78% coverage: 42:218/228 of query aligns to 28:206/650 of 5ws4A
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
37% identity, 73% coverage: 52:218/228 of query aligns to 34:201/223 of 2pclA
7arlD Lolcde in complex with lipoprotein and adp (see paper)
32% identity, 82% coverage: 42:228/228 of query aligns to 26:215/222 of 7arlD
7mdyC Lolcde nucleotide-bound
32% identity, 82% coverage: 42:228/228 of query aligns to 26:215/226 of 7mdyC
Sites not aligning to the query:
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
32% identity, 82% coverage: 42:228/228 of query aligns to 29:218/233 of P75957
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
31% identity, 82% coverage: 42:228/228 of query aligns to 28:217/229 of 7v8iD
Sites not aligning to the query:
P9WQK5 Uncharacterized ABC transporter ATP-binding protein Rv0073 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 74% coverage: 50:218/228 of query aligns to 36:205/330 of P9WQK5
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
34% identity, 85% coverage: 22:215/228 of query aligns to 3:202/226 of 5xu1B
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
33% identity, 85% coverage: 22:215/228 of query aligns to 1:205/232 of 1f3oA
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
37% identity, 66% coverage: 51:200/228 of query aligns to 32:182/219 of 8w6iD
Sites not aligning to the query:
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
37% identity, 66% coverage: 51:200/228 of query aligns to 32:182/222 of P0A9R7
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
32% identity, 85% coverage: 22:215/228 of query aligns to 1:205/230 of 1l2tA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
35% identity, 73% coverage: 52:218/228 of query aligns to 38:205/592 of 5lj7A
Sites not aligning to the query:
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
35% identity, 73% coverage: 52:218/228 of query aligns to 38:205/615 of 5lilA
Sites not aligning to the query:
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
36% identity, 66% coverage: 51:200/228 of query aligns to 32:182/218 of 8hd0A
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 78% coverage: 52:228/228 of query aligns to 36:213/343 of P30750
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
33% identity, 78% coverage: 39:216/228 of query aligns to 10:188/348 of 3d31A
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
32% identity, 78% coverage: 52:228/228 of query aligns to 37:214/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
32% identity, 78% coverage: 52:228/228 of query aligns to 37:214/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
32% identity, 78% coverage: 52:228/228 of query aligns to 37:214/344 of 6cvlD
Sites not aligning to the query:
>Echvi_2704 FitnessBrowser__Cola:Echvi_2704
MLHKNILSIRFVISAITKVLYMVSLSGVAFSYSKQKTFRFPNFTIDQAPLLILGPSGVGK
TTLLHLIAGFLSPQEGSIRIGEREVSQLKPSQMDRFRGRHIGMVFQQHHFIRSLDLMGNL
QLIQYLAGKSPSPQAIKALLGQLGLGEHLTRNPYAMSQGEQQRAAIAMALINKPSLILAD
EPTSSLDDENCHAVVKLLKDQALAHQADLIIITHDQRLKGEISEAITL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory