SitesBLAST
Comparing Echvi_2804 FitnessBrowser__Cola:Echvi_2804 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
29% identity, 91% coverage: 9:277/295 of query aligns to 8:290/306 of 5eynA
- active site: G246 (= G239), A247 (≠ S240), G248 (= G241), D249 (= D242)
- binding adenosine-5'-diphosphate: H91 (≠ K87), T217 (= T210), G219 (= G212), A220 (≠ S213), A238 (≠ Q231), V239 (= V232), T244 (= T237), G246 (= G239), A247 (≠ S240), G248 (= G241), F251 (= F244), N279 (≠ C266), G282 (= G269), A283 (= A270)
- binding beryllium trifluoride ion: G246 (= G239), G248 (= G241), D249 (= D242)
- binding beta-D-fructofuranose: D9 (≠ E10), D13 (= D14), G28 (= G24), A29 (= A25), N32 (= N28), F96 (≠ Y92), F98 (vs. gap), R159 (= R152), D249 (= D242)
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
28% identity, 91% coverage: 9:277/295 of query aligns to 12:294/310 of 5yggA
- binding adenosine-5'-diphosphate: K188 (= K172), T221 (= T210), G223 (= G212), A242 (≠ Q231), V243 (= V232), F255 (= F244), N283 (≠ C266), G286 (= G269), A287 (= A270)
- binding beta-D-fructofuranose: D13 (≠ E10), D17 (= D14), G32 (= G24), A33 (= A25), F100 (≠ Y92), F102 (vs. gap), R163 (= R152), D253 (= D242)
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
28% identity, 89% coverage: 22:283/295 of query aligns to 31:291/304 of 3ih0A
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
28% identity, 89% coverage: 22:283/295 of query aligns to 30:290/302 of 3gbuA
- active site: G242 (= G239), A243 (≠ S240), G244 (= G241), D245 (= D242)
- binding adenosine-5'-triphosphate: K188 (= K172), T213 (= T210), G215 (= G212), V235 (= V232), P237 (≠ V234), A243 (≠ S240), G244 (= G241), A274 (= A270)
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
28% identity, 94% coverage: 1:277/295 of query aligns to 4:292/319 of Q8ZKR2
- D16 (= D14) binding
- G31 (= G24) binding
- Y101 (≠ E93) binding
- R162 (= R152) binding
- A180 (≠ L165) binding
- A181 (≠ K166) binding
- A183 (≠ T168) binding
- G213 (≠ V207) binding
- D246 (= D236) binding
- T248 (≠ V238) binding
- D252 (= D242) binding
- A287 (≠ V272) binding
- A290 (≠ Q275) binding
- G292 (= G277) binding
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
27% identity, 86% coverage: 23:277/295 of query aligns to 32:290/308 of 2dcnA
- active site: G252 (= G239), A253 (≠ S240), G254 (= G241), D255 (= D242)
- binding adenosine-5'-diphosphate: D193 (≠ N174), K223 (≠ T210), G225 (= G212), P226 (≠ S213), G228 (= G215), V247 (= V234), G254 (= G241), I279 (≠ C266), S282 (≠ G269), V286 (≠ A273)
- binding 6-O-phosphono-beta-D-psicofuranosonic acid: G33 (= G24), F89 (≠ V80), Y105 (vs. gap), R107 (vs. gap), I136 (≠ S123), R165 (= R152), T251 (≠ V238), G252 (= G239), D255 (= D242)
Sites not aligning to the query:
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
27% identity, 93% coverage: 4:277/295 of query aligns to 2:281/297 of 1tz6A
- active site: C24 (≠ L21), F88 (≠ I90), G238 (= G239), A239 (≠ S240), G240 (= G241), D241 (= D242)
- binding phosphomethylphosphonic acid adenylate ester: N149 (= N150), K176 (= K172), E181 (= E177), S209 (vs. gap), G211 (= G212), A212 (≠ S213), G214 (= G215), A239 (≠ S240), G240 (= G241), F243 (= F244), N270 (≠ C266), G273 (= G269), A274 (= A270)
- binding 5-aminoimidazole ribonucleoside: D8 (≠ E10), D12 (= D14), G27 (= G24), F88 (≠ I90), Y90 (= Y92), R151 (= R152), M154 (≠ H155), D241 (= D242)
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
28% identity, 86% coverage: 23:277/295 of query aligns to 33:286/309 of Q53W83
- GAEVN 34:38 (≠ GAPMN 24:28) binding
- YYR 103:105 (≠ VDN 82:84) binding
- R167 (= R152) binding
- S193 (≠ N174) binding
- 219:225 (vs. 210:216, 43% identical) binding
- GAGD 248:251 (≠ GSGD 239:242) binding
- D251 (= D242) binding
- N275 (≠ C266) binding
Sites not aligning to the query:
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
27% identity, 93% coverage: 4:277/295 of query aligns to 2:281/299 of 1tz3A
- active site: C24 (≠ L21), F88 (≠ I90), G238 (= G239), A239 (≠ S240), G240 (= G241), D241 (= D242)
- binding 5-aminoimidazole ribonucleoside: D8 (≠ E10), S10 (≠ L12), D12 (= D14), G27 (= G24), L83 (≠ V81), F88 (≠ I90), Y90 (= Y92), R151 (= R152), M154 (≠ H155), D241 (= D242)
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
28% identity, 86% coverage: 23:277/295 of query aligns to 33:286/300 of 1v1bA
- active site: G248 (= G239), A249 (≠ S240), G250 (= G241), D251 (= D242)
- binding adenosine-5'-triphosphate: K219 (≠ T210), G221 (= G212), A238 (≠ G229), F239 (≠ Y230), V241 (= V232), G248 (= G239), A249 (≠ S240), G250 (= G241), N275 (≠ C266), A279 (= A270)
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
28% identity, 86% coverage: 23:277/295 of query aligns to 33:286/301 of 1v1aA
- active site: G248 (= G239), A249 (≠ S240), G250 (= G241), D251 (= D242)
- binding adenosine-5'-diphosphate: K219 (≠ T210), G221 (= G212), A222 (≠ S213), A249 (≠ S240), G250 (= G241), N275 (≠ C266), A279 (= A270)
- binding 2-keto-3-deoxygluconate: G34 (= G24), A35 (= A25), N38 (= N28), Y89 (≠ F68), R105 (≠ N84), R167 (= R152), G248 (= G239), D251 (= D242)
Sites not aligning to the query:
7fcaD Pfkb(mycobacterium marinum) (see paper)
23% identity, 83% coverage: 4:249/295 of query aligns to 3:237/282 of 7fcaD
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
25% identity, 86% coverage: 23:277/295 of query aligns to 33:293/313 of Q97U29
Sites not aligning to the query:
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
25% identity, 86% coverage: 23:277/295 of query aligns to 32:292/311 of 2varA
- active site: G254 (= G239), A255 (≠ S240), G256 (= G241), D257 (= D242)
- binding adenosine monophosphate: G227 (= G212), G230 (= G215), M259 (≠ F244), S284 (≠ G269), I288 (≠ A273)
- binding phosphoaminophosphonic acid-adenylate ester: K225 (≠ E203), G227 (= G212), S228 (= S213), G230 (= G215), G254 (= G239), A255 (≠ S240), G256 (= G241), D257 (= D242), M259 (≠ F244), I281 (≠ C266), S284 (≠ G269), I288 (≠ A273)
- binding 3-deoxy-alpha-D-erythro-hex-2-ulofuranosonic acid: G33 (= G24), S34 (≠ A25), Y89 (≠ V80), Y105 (vs. gap), R107 (vs. gap), I136 (≠ S123), R165 (= R152), G254 (= G239), D257 (= D242)
- binding 2-keto-3-deoxygluconate: G33 (= G24), S34 (≠ A25), Y89 (≠ V80), L103 (≠ I94), Y105 (vs. gap), R107 (vs. gap), I136 (≠ S123), R165 (= R152), T253 (≠ V238), G254 (= G239), D257 (= D242)
Sites not aligning to the query:
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
25% identity, 82% coverage: 9:251/295 of query aligns to 12:264/312 of 4wjmA
- active site: G252 (= G239), A253 (≠ S240), G254 (= G241), D255 (= D242)
- binding phosphoaminophosphonic acid-adenylate ester: T223 (= T210), G225 (= G212), A226 (≠ S213), G228 (= G215), G252 (= G239), A253 (≠ S240), G254 (= G241), V257 (≠ F244)
Sites not aligning to the query:
8cqxA Ribokinase from t.Sp mutant a92g
26% identity, 91% coverage: 22:290/295 of query aligns to 35:297/300 of 8cqxA
- binding adenosine-5'-diphosphate: N179 (= N174), T217 (= T210), G219 (= G212), A220 (≠ S213), G222 (= G215), F250 (= F244), N272 (≠ C266), G275 (= G269), A276 (= A270), T279 (≠ A273)
- binding magnesium ion: D242 (= D236), T244 (≠ V238), A278 (≠ V272), S287 (≠ R281)
5c3yA Structure of human ribokinase crystallized with amppnp
25% identity, 82% coverage: 23:263/295 of query aligns to 38:274/306 of 5c3yA
Sites not aligning to the query:
Q9H477 Ribokinase; RK; EC 2.7.1.15 from Homo sapiens (Human)
25% identity, 82% coverage: 23:263/295 of query aligns to 52:288/322 of Q9H477
Sites not aligning to the query:
2fv7A Crystal structure of human ribokinase
25% identity, 82% coverage: 23:263/295 of query aligns to 38:274/308 of 2fv7A
- active site: G252 (= G239), A253 (≠ S240), G254 (= G241), D255 (= D242)
- binding adenosine-5'-diphosphate: N185 (= N174), T221 (= T210), G223 (= G212), G226 (= G215), T242 (≠ G229), V245 (= V232), A253 (≠ S240), G254 (= G241)
Sites not aligning to the query:
6wk0B Crystal structure of human ribokinase in complex with amppcp and ribose
25% identity, 82% coverage: 23:263/295 of query aligns to 39:275/311 of 6wk0B
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N174), T222 (= T210), G224 (= G212), A225 (≠ S213), G227 (= G215), T243 (≠ G229), V246 (= V232), A254 (≠ S240), G255 (= G241)
- binding alpha-D-ribofuranose: G40 (= G24), K41 (≠ A25), N44 (= N28), A96 (≠ S78), E141 (≠ S123), D256 (= D242)
Sites not aligning to the query:
Query Sequence
>Echvi_2804 FitnessBrowser__Cola:Echvi_2804
MNKKAVIFGEMLWDCFPDKQLPGGAPMNVALHLQHLGITTTFISKIGSDSLGADLLSFVQ
KNGLNGDFVQRDTAHETSRVVVDNSDKENIKYEIVKPVAWDFMEWNTAIQEKVDEADVFV
FGSLAARSSQSQNTLFRLLETSTLKVLDINLRPPHYSTKVLERLLKNTDVLKINEDELEI
LIEMSALDKNEEKALSAIVDRYELQLVCMTKGSAGAIIYDGREFYRHPGYQVDVEDTVGS
GDAFLSGFISQYLKGNHPNKILDFACALGALVATQKGGTPRYDTDQITAIQDNNS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory