SitesBLAST
Comparing Echvi_2805 FitnessBrowser__Cola:Echvi_2805 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
35% identity, 98% coverage: 1:439/448 of query aligns to 1:475/491 of P0AGF4
- F24 (= F21) mutation to A: Decreases xylose transport.
- G83 (= G72) mutation to A: Abolishes xylose transport.
- R133 (= R104) mutation R->C,H,L: Abolishes xylose transport.
- E153 (= E124) mutation to A: Abolishes xylose transport.
- R160 (= R131) mutation to A: Abolishes xylose transport.
- Q168 (= Q139) binding ; mutation to A: Abolishes xylose transport.
- Q288 (≠ N257) mutation to A: Abolishes xylose transport.
- QQ 288:289 (≠ NQ 257:258) binding
- Q289 (= Q258) mutation to A: Strongly decreases xylose transport.
- N294 (= N263) binding ; mutation to A: Abolishes xylose transport.
- Y298 (= Y267) mutation to A: Abolishes xylose transport.
- N325 (= N294) mutation to A: No effect on xylose transport.
- G340 (= G309) mutation to A: Abolishes xylose transport.
- R341 (= R310) mutation R->A,W: Abolishes xylose transport.
- W392 (= W362) binding ; mutation to A: Abolishes xylose transport.
- E397 (= E367) mutation to A: Abolishes xylose transport.
- R404 (= R374) mutation to A: Strongly decreases xylose transport.
- Q415 (≠ H385) binding
- W416 (= W386) mutation to A: Strongly decreases xylose transport.
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
35% identity, 98% coverage: 3:439/448 of query aligns to 2:471/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
35% identity, 98% coverage: 3:439/448 of query aligns to 2:471/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
35% identity, 98% coverage: 3:439/448 of query aligns to 2:471/475 of 4gbyA
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
35% identity, 100% coverage: 1:447/448 of query aligns to 1:442/446 of A0A0H2VG78
- D22 (= D24) mutation to N: Affects symport activity. May function as an uniporter.
- R102 (= R104) mutation to A: Loss of transport activity.
- I105 (≠ G107) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E124) mutation to A: Loss of transport activity.
- Q137 (= Q139) mutation to A: Loss of transport activity.
- Q250 (≠ N257) mutation to A: Loss of transport activity.
- Q251 (= Q258) mutation to A: Loss of transport activity.
- N256 (= N263) mutation to A: Loss of transport activity.
- W357 (= W362) mutation to A: Loss of transport activity.
Q8VZR6 Inositol transporter 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 98% coverage: 4:440/448 of query aligns to 28:477/509 of Q8VZR6
Sites not aligning to the query:
- 479:509 mutation Missing: Leads to endoplasmic reticulum relocalization.
- 481:482 ER→AA: No effect on targeting.
- 500:509 mutation Missing: Leads to endoplasmic reticulum relocalization.
- 502:504 mutation LLE->AAA,SSS: Leads to plasma membrane relocalization.
P11166 Solute carrier family 2, facilitated glucose transporter member 1; Glucose transporter type 1, erythrocyte/brain; GLUT-1; HepG2 glucose transporter from Homo sapiens (Human) (see 23 papers)
31% identity, 96% coverage: 14:443/448 of query aligns to 19:468/492 of P11166
- N34 (≠ S29) to S: in GLUT1DS1; 55% of wild-type glucose uptake activity; dbSNP:rs80359812
- N45 (≠ Q40) modified: carbohydrate, N-linked (GlcNAc...) asparagine; mutation to T: Loss of glycosylation site.
- R51 (vs. gap) to H: in EIG12; uncertain significance; dbSNP:rs201815571
- T60 (vs. gap) to M: in EIG12; uncertain significance; decreased glucose transport; dbSNP:rs142986731
- M77 (≠ V58) to T: in EIG12; decreased glucose transport; dbSNP:rs1187210267
- G91 (= G72) to D: in GLUT1DS1; significantly decreases the transport of 3-O-methyl-D-glucose; dbSNP:rs80359814
- R126 (= R104) to C: in GLUT1DS1, GLUT1DS2 and DYT9; reduced transporter activity; dbSNP:rs80359818; to H: in GLUT1DS1; significantly decreases the transport of 3-O-methyl-D-glucose and dehydroascorbic acid; 57% of wild-type glucose uptake activity; dbSNP:rs80359816
- G130 (= G108) to S: in GLUT1DS1; 75% of wild-type glucose uptake activity; dbSNP:rs80359819
- T137 (≠ S115) binding
- P149 (= P127) to A: in EIG12; uncertain significance
- R153 (= R131) to C: in GLUT1DS1; 44% of wild-type glucose uptake activity
- L169 (= L147) natural variant: Missing (in GLUT1DS1; 48% of wild-type glucose uptake activity; dbSNP:rs80359832)
- I192 (≠ M171) mutation to C: Strongly decreases glucose transport.
- L204 (≠ S183) mutation to C: Abolishes glucose transport.
- P205 (≠ I184) mutation to C: Abolishes glucose transport.
- R212 (= R191) to C: in GLUT1DS1 and DYT9; dbSNP:rs387907312
- R218 (≠ H197) to S: in EIG12; decreased glucose transport
- R223 (≠ E202) to P: in EIG12; mild phenotype; reduced transporter activity; impaired phosphorylation by PKC; dbSNP:rs397514564; to Q: in EIG12; uncertain significance; no effect on glucose transport; impaired phosphorylation by PKC; dbSNP:rs397514564; to W: in GLUT1DS1; impaired phosphorylation by PKC; dbSNP:rs796053248
- S226 (≠ Q205) modified: Phosphoserine; by PKC/PRKCB; mutation to A: Abolishes phosphorylation by PKA, leading to impaired response to TPA.
- R232 (≠ E213) to C: in EIG12; the mutant protein is expressed at the cell surface but has mildly decreased glucose uptake (70%) compared to wild-type; dbSNP:rs387907313
- E243 (vs. gap) to V: in EIG12; decreased glucose transport
- A275 (= A250) to T: in GLUT1DS2; the mutation decreases glucose transport but does not affect cation permeability; dbSNP:rs121909740
- Q282 (≠ N257) binding
- QQLS 282:285 (≠ NQLS 257:260) natural variant: Missing (in GLUT1DS2; accompanied by hemolytic anemia and altered erythrocyte ion concentrations; the mutation decreases glucose transport and causes a cation leak that alteres intracellular concentrations of sodium potassium and calcium)
- G286 (= G261) to D: in SDCHCN; no effect on protein abundance; no effect on localization to the plasma membrane; loss of D-glucose transporter activity; increased cation leakage; dbSNP:rs864309514
- T295 (≠ P270) to M: in GLUT1DS1; 75% of wild-type glucose uptake activity; dbSNP:rs80359823
- V303 (≠ I278) to L: found in a patient with GLUT1 deficiency syndrome; dbSNP:rs1205631854
- G314 (= G291) to S: in GLUT1DS2; the mutation decreases glucose transport but does not affect cation permeability; dbSNP:rs121909739
- S324 (≠ G301) to L: in GLUT1DS2; mild phenotype; reduced transporter activity; dbSNP:rs796053253
- E329 (≠ D306) to Q: in GLUT1DS1; stabilizes the inward-open conformation
- R333 (= R310) to Q: in GLUT1DS1 and GLUT1DS2; dbSNP:rs1553155986; to W: in GLUT1DS1; 43% of wild-type glucose uptake activity; dbSNP:rs80359825
- G340 (= G317) mutation to C: Strongly decreases glucose transport.
- W388 (= W362) binding
- N411 (≠ H385) Not glycosylated; binding ; to S: in EIG12; decreased glucose transport; dbSNP:rs398123069
- I435 (≠ G410) natural variant: Missing (in SDCHCN; no effect on protein abundance; no effect on localization to the plasma membrane; loss of D-glucose transporter activity; increased cation leakage)
- R458 (= R433) to W: in EIG12; decreased glucose transport; dbSNP:rs13306758
Sites not aligning to the query:
- 485 P → L: in GLUT1DS1; creates a dileucine internalization motif that promotes recruitment of clathrin and mislocalization of the protein to endocytic compartments
P17809 Solute carrier family 2, facilitated glucose transporter member 1; Glucose transporter type 1, erythrocyte/brain; GLUT-1; GT1 from Mus musculus (Mouse) (see 3 papers)
31% identity, 96% coverage: 14:443/448 of query aligns to 19:468/492 of P17809
- N45 (≠ Q40) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Sites not aligning to the query:
- 485 P→L: Lethality immediately after birth in knockin mice; caused by creation of a dileucine internalization motif that promotes mislocalization of the protein.
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 71% coverage: 6:325/448 of query aligns to 27:355/580 of Q9C757
Sites not aligning to the query:
- 399 C→A: Strongly decreased nickel inhibition; when associated with A-402, A-410 and A-413.; C→S: No effect on inostol transport or nickel inhibition. No effect on inostol transport or nickel inhibition; when associated with S-410.
- 402 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-410 and A-413.
- 410 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-413.; C→S: No effect on inostol transport or nickel inhibition; when associated with S-399.
- 413 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-410.
Q9LT15 Sugar transport protein 10; AtSTP10; D-glucose-H(+) symport protein STP10; D-glucose-proton symporter STP10; Hexose transporter 10 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
31% identity, 97% coverage: 6:438/448 of query aligns to 24:485/514 of Q9LT15
- F39 (= F21) mutation to A: Reduces affinity for glucose 8-fold.
- L43 (≠ T25) mutation to A: Reduces affinity for glucose 150-fold and turns STP10 into a low affinity transporter.
- C77 (≠ A51) modified: Disulfide link with 449; mutation to A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
- E162 (= E124) mutation to Q: Abolishes glucose transport activity; when associated with N-344.
- Q177 (= Q139) binding ; mutation to A: Reduces affinity for glucose 37-fold.
- I184 (= I146) mutation to A: Reduces affinity for glucose 3-fold.
- Q295 (≠ N257) binding
- Q296 (= Q258) binding
- N301 (= N263) binding
- N332 (= N294) binding
- D344 (= D306) mutation to N: Abolishes glucose transport activity; when associated with Q-162.
- W410 (= W362) binding
- C449 (≠ F399) modified: Disulfide link with 77; mutation to A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
7aaqA Sugar/h+ symporter stp10 in outward occluded conformation (see paper)
31% identity, 97% coverage: 6:438/448 of query aligns to 4:465/487 of 7aaqA
7aarA Sugar/h+ symporter stp10 in inward open conformation (see paper)
30% identity, 97% coverage: 6:438/448 of query aligns to 9:470/485 of 7aarA
- binding Octyl Glucose Neopentyl Glycol : L28 (≠ T25), I90 (≠ P67), H94 (≠ Y71), V98 (≠ T75), F101 (≠ L78), N138 (≠ S115), P142 (= P119), N158 (≠ V135), F161 (≠ Y138), Q162 (= Q139), I165 (= I142), D210 (≠ K188), G391 (= G358), P392 (≠ S359), W395 (= W362), M419 (≠ W386)
- binding beta-D-glucopyranose: Q280 (≠ N257), N286 (= N263), M289 (≠ I266), G391 (= G358), W395 (= W362)
5eqiA Human glut1 in complex with cytochalasin b (see paper)
30% identity, 93% coverage: 14:430/448 of query aligns to 11:447/447 of 5eqiA
5eqhA Human glut1 in complex with inhibitor (2~{s})-3-(2-bromophenyl)-2-[2- (4-methoxyphenyl)ethanoylamino]-~{n}-[(1~{s})-1- phenylethyl]propanamide (see paper)
30% identity, 93% coverage: 14:430/448 of query aligns to 11:447/447 of 5eqhA
5eqgA Human glut1 in complex with inhibitor (2~{s})-3-(4-fluorophenyl)-2-[2- (3-hydroxyphenyl)ethanoylamino]-~{n}-[(1~{s})-1- phenylethyl]propanamide (see paper)
30% identity, 93% coverage: 14:430/448 of query aligns to 11:447/447 of 5eqgA
P11168 Solute carrier family 2, facilitated glucose transporter member 2; Glucose transporter type 2, liver; GLUT-2 from Homo sapiens (Human) (see 6 papers)
28% identity, 99% coverage: 7:448/448 of query aligns to 10:505/524 of P11168
- P68 (vs. gap) to L: in dbSNP:rs7637863
- T110 (≠ I59) to I: in dbSNP:rs5400
- V197 (= V143) to I: in NIDDM; abolishes transport activity of the transporter expressed in Xenopus oocytes; dbSNP:rs121909741
- I322 (= I265) mutation to V: Reduced fructose transport.
P11169 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Homo sapiens (Human) (see paper)
30% identity, 97% coverage: 7:440/448 of query aligns to 10:463/496 of P11169
- Q159 (= Q139) binding
- QLS 277:279 (≠ ALF 254:256) Important for selectivity against fructose; mutation to HVA: Confers moderate fructose transport activity.
- QQ 280:281 (≠ NQ 257:258) binding
- N286 (= N263) binding
- N315 (= N294) binding
- E378 (≠ A354) binding
- W386 (= W362) binding
7spsA Crystal structure of human glucose transporter glut3 bound with exofacial inhibitor sa47 (see paper)
29% identity, 98% coverage: 7:443/448 of query aligns to 7:463/468 of 7spsA
- binding methyl N-[(2-{4-[4-(5-fluoro-2-methoxyphenyl)piperazin-1-yl]-1H-pyrazolo[3,4-d]pyrimidin-1-yl}phenyl)methyl]-beta-alaninate: F21 (= F21), T25 (= T25), N29 (≠ S29), Q156 (= Q139), I163 (= I146), Q278 (= Q258), F286 (≠ I266), A308 (≠ I290), N312 (= N294), F374 (≠ H353), E375 (≠ A354), N406 (≠ H385), W407 (= W386), N410 (≠ A389)
7crzA Crystal structure of human glucose transporter glut3 bound with c3361 (see paper)
29% identity, 98% coverage: 7:443/448 of query aligns to 8:464/469 of 7crzA
- binding (2S,3R,4S,5R,6R)-6-(hydroxymethyl)-4-undec-10-enoxy-oxane-2,3,5-triol: T26 (= T25), A66 (= A51), S69 (≠ L54), Q157 (= Q139), I164 (= I146), Q278 (≠ N257), Q279 (= Q258), N284 (= N263), N313 (= N294), F375 (≠ H353), W384 (= W362), N411 (≠ A389), F412 (≠ A390), G415 (≠ A393)
4zw9A Crystal structure of human glut3 bound to d-glucose in the outward- occluded conformation at 1.5 angstrom (see paper)
29% identity, 98% coverage: 7:443/448 of query aligns to 10:466/470 of 4zw9A
- binding beta-D-glucopyranose: Q159 (= Q139), I166 (= I146), Q280 (≠ N257), Q281 (= Q258), N286 (= N263), F377 (≠ H353), W386 (= W362)
- binding alpha-D-glucopyranose: Q159 (= Q139), I162 (= I142), I166 (= I146), Q280 (≠ N257), Q281 (= Q258), N286 (= N263), W386 (= W362)
Query Sequence
>Echvi_2805 FitnessBrowser__Cola:Echvi_2805
MNSKKYVIFLSIVAALGGFLFGFDTAVISGAERFIQEKWQLSDWTHGMAVAIALYGTVIG
ALFGGIPADKYGRKTSLLWIGVLYFISALGSALAPDVYSFMFFRFIGGLGVGASSVVAPM
YISEIAPAKNRGVLVALYQFNIVFGILMAYFSNYLIEMADLNESWRWMMGMEAIPALIYT
LLSIRVPKSPRWLIAHHNKVEEATQILRKTDPEGVDEAIHLAIEERNREKIKVGFAVLFK
HSHLKTTLLAIMIALFNQLSGINAIIYFAPRVFEMAGIDQKSALLSTIGIGVVNMIATMI
GLYLIDRIGRKKLMVIGSIGYIISLLLMAYSFSGGVINSGYLPLFVFVFIASHAVGQGSV
IWVFISEVFPNETRAFGQSIGCFTHWILAAVIANVFPFFANSFGPASIFGFFAVMMGLQL
LWVLTKMPETKGRSLEEIQQDLKIKQGT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory