SitesBLAST
Comparing Echvi_2806 FitnessBrowser__Cola:Echvi_2806 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q96TU3 Extracellular exo-inulinase inuE; EC 3.2.1.80 from Aspergillus awamori (Black koji mold) (see 2 papers)
37% identity, 93% coverage: 34:497/498 of query aligns to 21:537/537 of Q96TU3
- N67 (≠ P80) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N111 (≠ G119) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N300 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N398 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N430 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Sites not aligning to the query:
1y9gA Crystal structure of exo-inulinase from aspergillus awamori complexed with fructose (see paper)
37% identity, 93% coverage: 34:496/498 of query aligns to 2:517/517 of 1y9gA
- active site: D22 (= D54), E222 (= E232)
- binding beta-D-fructofuranose: N21 (= N53), D22 (= D54), Q38 (= Q70), W46 (= W78), F83 (= F110), S84 (= S111), R169 (= R177), D170 (= D178), E222 (= E232), Y294 (= Y294), W316 (= W318)
O94220 Extracellular endo-inulinase inu2; 2,1-beta-D-fructanfructanohydrolase; Inulase; EC 3.2.1.7 from Aspergillus ficuum (see 2 papers)
35% identity, 87% coverage: 39:472/498 of query aligns to 28:488/516 of O94220
- M41 (= M52) mutation to A: Decreases catalytic activity.
- N42 (= N53) mutation to G: Strongly decreases catalytic activity.
- E43 (≠ D54) mutation to D: Strongly decreases catalytic activity.
- Q59 (= Q70) mutation to A: Impairs catalytic activity.
- N61 (≠ Y72) binding
- P62 (= P73) mutation to G: Impairs catalytic activity.
- W67 (= W78) mutation to A: Impairs catalytic activity.
- I70 (≠ M81) mutation to A: Decreases catalytic activity.
- F99 (= F110) mutation to A: Strongly decreases catalytic activity.
- R175 (= R177) mutation to A: Impairs catalytic activity.
- D176 (= D178) binding
- N265 (≠ S263) mutation to A: Decreases catalytic activity.
- R295 (≠ T291) mutation to A: Decreases catalytic activity.
- D298 (≠ Y294) mutation to A: Decreases catalytic activity.
- N320 (≠ S316) binding
- N372 (≠ G370) modified: carbohydrate, N-linked (GlcNAc...) asparagine
3rwkX First crystal structure of an endo-inulinase, from aspergillus ficuum: structural analysis and comparison with other gh32 enzymes. (see paper)
35% identity, 87% coverage: 39:472/498 of query aligns to 5:465/493 of 3rwkX
- binding beta-D-fructofuranose: W17 (= W51), M18 (= M52), N19 (= N53), E20 (≠ D54), N38 (≠ Y72), F76 (= F110), T77 (≠ S111), R152 (= R177), D153 (= D178), E210 (= E232), N297 (≠ S316), G300 (≠ A321)
- binding alpha-D-mannopyranose: G241 (= G262), N242 (≠ S263), R272 (≠ T291), R272 (≠ T291), S298 (≠ N317), D417 (≠ E426), P418 (≠ E427), P418 (≠ E427), A419 (≠ G428)
8besA Structure of d188a-fructofuranosidase from rhodotorula dairenensis in complex with fructose (see paper)
33% identity, 95% coverage: 22:496/498 of query aligns to 15:526/526 of 8besA
- binding beta-D-fructofuranose: N46 (= N53), Q64 (= Q70), F105 (= F110), S106 (= S111), R170 (= R177), D171 (= D178), E221 (= E232)
- binding alpha-D-mannopyranose: V18 (≠ R25), T20 (≠ K27), G21 (≠ K28), P92 (= P98), Y151 (≠ R157), A317 (vs. gap)
Sites not aligning to the query:
8betA Structure of d188a-fructofuranosidase from rhodotorula dairenesis in complex with sucrose (see paper)
33% identity, 95% coverage: 22:496/498 of query aligns to 15:525/525 of 8betA
- binding beta-D-fructofuranose: N46 (= N53), Q64 (= Q70), Q75 (≠ M81), S106 (= S111), R170 (= R177), D171 (= D178), E221 (= E232)
- binding alpha-D-glucopyranose: F105 (= F110), E221 (= E232), N246 (= N255)
- binding alpha-D-mannopyranose: V18 (≠ R25), T20 (≠ K27), V23 (≠ A30), P92 (= P98), Y151 (≠ R157), S316 (≠ T327), A317 (vs. gap)
Sites not aligning to the query:
8beqA Structure of fructofuranosidase from rhodotorula dairenensis (see paper)
33% identity, 95% coverage: 22:496/498 of query aligns to 17:533/534 of 8beqA
Sites not aligning to the query:
6s2bA Structure of beta-fructofuranosidase from schwanniomyces occidentalis complexed with fructosyl-erythritol (see paper)
35% identity, 87% coverage: 40:470/498 of query aligns to 13:479/512 of 6s2bA
- active site: A27 (≠ D54), E207 (= E232)
- binding (2~{S},3~{R})-4-[(2~{R},3~{S},4~{S},5~{R})-2,5-bis(hydroxymethyl)-3,4-bis(oxidanyl)oxolan-2-yl]oxybutane-1,2,3-triol: N26 (= N53), Q45 (= Q70), W53 (= W78), F87 (= F110), S88 (= S111), R155 (= R177), D156 (= D178), E207 (= E232), Y270 (= Y294), W291 (= W318)
6s1tA Structure of beta-fructofuranosidase from schwanniomyces occidentalis complexed with sucrose (see paper)
35% identity, 87% coverage: 40:470/498 of query aligns to 13:479/512 of 6s1tA
- active site: A27 (≠ D54), E207 (= E232)
- binding beta-D-fructofuranose: N26 (= N53), Q45 (= Q70), F87 (= F110), S88 (= S111), R155 (= R177), D156 (= D178), E207 (= E232), Y270 (= Y294)
- binding alpha-D-glucopyranose: W53 (= W78), E207 (= E232), W291 (= W318)
P00724 Invertase 2; Beta-fructofuranosidase 2; Saccharase; EC 3.2.1.26 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
35% identity, 87% coverage: 40:470/498 of query aligns to 28:501/532 of P00724
- D42 (= D54) active site; mutation to N: Loss of activity.
- N64 (≠ D74) modified: carbohydrate, N-linked (GlcNAc...) asparagine; partial
- N97 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N111 (≠ G119) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N118 (≠ K126) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N165 (≠ P171) modified: carbohydrate, N-linked (GlcNAc...) asparagine; partial
- N266 (≠ D273) modified: carbohydrate, N-linked (GlcNAc...) asparagine; partial
- N275 (≠ E282) modified: carbohydrate, N-linked (GlcNAc...) asparagine; partial
- N356 (≠ E357) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N369 (≠ T364) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N384 (≠ D377) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N398 (≠ S391) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Sites not aligning to the query:
- 1:19 signal peptide
- 23 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 512 modified: carbohydrate, N-linked (GlcNAc...) asparagine; partial
O33833 Beta-fructosidase; Invertase; Sucrase; EC 3.2.1.26 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
32% identity, 92% coverage: 39:496/498 of query aligns to 2:431/432 of O33833
- E190 (= E232) mutation to A: Loss of activity.; mutation to D: Reduced activity.
1w2tB Beta-fructosidase from thermotoga maritima in complex with raffinose (see paper)
31% identity, 92% coverage: 39:496/498 of query aligns to 2:431/432 of 1w2tB
- active site: D17 (= D54), D190 (≠ E232)
- binding beta-D-fructofuranose: N16 (= N53), D17 (= D54), Q33 (= Q70), F74 (= F110), S75 (= S111), D138 (= D178), D190 (≠ E232), Y240 (= Y294)
- binding alpha-D-glucopyranose: R137 (= R177), T208 (≠ N260), W260 (= W318)
1w2tA Beta-fructosidase from thermotoga maritima in complex with raffinose (see paper)
31% identity, 92% coverage: 39:496/498 of query aligns to 2:431/432 of 1w2tA
7bwcA Bombyx mori gh32 beta-fructofuranosidase bmsuc1 mutant d63a in complex with sucrose (see paper)
33% identity, 90% coverage: 26:473/498 of query aligns to 10:439/464 of 7bwcA
- binding beta-D-fructofuranose: N38 (= N53), Q55 (= Q70), M66 (= M81), F94 (= F110), S95 (= S111), R156 (= R177), D157 (= D178), E210 (= E232), W293 (= W318)
- binding alpha-D-glucopyranose: W63 (= W78), E210 (= E232), Q228 (≠ N255), W293 (= W318)
7vcpA Frischella perrara beta-fructofuranosidase in complex with fructose (see paper)
31% identity, 88% coverage: 38:473/498 of query aligns to 24:461/490 of 7vcpA
4ffgA Crystal structure of levan fructotransferase from arthrobacter ureafaciens in complex with dfa-iv (see paper)
30% identity, 86% coverage: 43:469/498 of query aligns to 3:449/480 of 4ffgA
- active site: D14 (= D54), E196 (= E232)
- binding (1R,4R,5S,6S,7R,10R,11S,12S)-1,7-bis(hydroxymethyl)-2,8,13,14-tetraoxatricyclo[8.2.1.1~4,7~]tetradecane-5,6,11,12-tetrol: N368 (≠ R393), Y393 (≠ I414), D395 (= D416), R411 (= R432)
- binding beta-D-fructofuranose: D128 (≠ P171), Y167 (≠ K202), N184 (≠ D219), D186 (≠ N221)
Sites not aligning to the query:
- binding (1R,4R,5S,6S,7R,10R,11S,12S)-1,7-bis(hydroxymethyl)-2,8,13,14-tetraoxatricyclo[8.2.1.1~4,7~]tetradecane-5,6,11,12-tetrol: 463
4ffhA Crystal structure of levan fructotransferase d54n mutant from arthrobacter ureafaciens in complex with sucrose (see paper)
30% identity, 86% coverage: 43:469/498 of query aligns to 3:449/480 of 4ffhA
- active site: N14 (≠ D54), E196 (= E232)
- binding beta-D-fructofuranose: N14 (≠ D54), W68 (≠ F110), S69 (= S111), R145 (= R177), D146 (= D178), E196 (= E232), Y258 (= Y294), N368 (≠ R393), N384 (= N411), Y388 (vs. gap), Y393 (≠ I414), D395 (= D416), R411 (= R432)
- binding alpha-D-glucopyranose: R99 (≠ E142), R145 (= R177), E196 (= E232)
3pijB Beta-fructofuranosidase from bifidobacterium longum - complex with fructose (see paper)
28% identity, 94% coverage: 28:495/498 of query aligns to 30:515/526 of 3pijB
- active site: D54 (= D54), E235 (= E232)
- binding beta-D-fructofuranose: N53 (= N53), D54 (= D54), Q70 (= Q70), M81 (= M81), F113 (= F110), S114 (= S111), R180 (= R177), D181 (= D178), E235 (= E232), Y302 (= Y294)
6nunA Structure of gh32 hydrolase from bifidobacterium adolescentis in complex with frutose
28% identity, 91% coverage: 41:495/498 of query aligns to 39:513/516 of 6nunA
Q39041 Acid beta-fructofuranosidase 4, vacuolar; At beta fruct4; AtBETAFRUCT4; Acid invertase 4; AI 4; Acid sucrose hydrolase 4; Vacuolar invertase 4; Inv-V4; VAC-INV 4; VI 4; EC 3.2.1.26 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
27% identity, 87% coverage: 40:472/498 of query aligns to 121:616/664 of Q39041
Sites not aligning to the query:
- 2 mutation Missing: No effect on localization.
- 3 mutation Missing: Partial retention in the endoplasmic reticulum.
- 3:4 mutation Missing: Endoplasmic reticulum localization.
- 4 mutation Missing: Partial retention in the endoplasmic reticulum.
- 5 mutation Missing: Endoplasmic reticulum localization.
- 6 mutation Missing: No effect on localization.
- 7 mutation Missing: Partial retention in the endoplasmic reticulum.
- 7:8 Critical for endoplasmic reticulum export; LL→AA: Reduced vacuolar trafficking.; mutation Missing: Endoplasmic reticulum localization.
- 8 mutation Missing: Partial retention in the endoplasmic reticulum.
- 9 P→A: Partial retention in the endoplasmic reticulum.
- 9:10 Critical for endoplasmic reticulum export; PI→AA: Reduced vacuolar trafficking.
- 10 mutation Missing: Endoplasmic reticulum localization.
- 11 mutation Missing: Endoplasmic reticulum localization.
- 12 mutation Missing: No effect on localization.
- 14:16 Critical for trafficking from the trans-Golgi network to the prevacuolar compartment and from the prevacuolar compartment to the central vacuole; EEE→AAA: Reduced vacuolar trafficking.
- 18:21 LCPY→AAAA: Reduced vacuolar trafficking.
- 21:24 YTRL→AAAA: Reduced vacuolar trafficking.; mutation Missing: No effect on localization.
Query Sequence
>Echvi_2806 FitnessBrowser__Cola:Echvi_2806
MNLYIKPIMLFTVLVSITSCSPNTREKKMAVQKSFDEQFRPQYHFSPPQQWMNDPNGMVY
LDGEYHLFYQHYPDSNVWGPMHWGHAVSEDLLHWDHLPIALYPDSLGYIFSGSAVIDHGN
TSGLGKNGQDPMVAIFTYHHDENGQSQGIAFSNDKGRSWTKYRNNPVLESPGIPDFRDPK
VSWYDRGNGSGKWIMTLAVKDKISFYSSPNLIDWTHESDFNPEWAAYGGVWECPDLFPLK
TNSGNEKWMLLVSINPGGPNGGSATQYFIGNFDGQNYTAEGESIKWLDYGTDNYAGVTWS
NIPPEDGRRLFIGWMSNWQYANIVPTTEWRSANTIPRELALITDHGVERVASRPIKELEQ
LRQTTEIIQGSTHALKDPLFELELEKESGESARITLKNELGEKVMITFEDNQLIFDRTES
GKISFEEGFGKRITAPITDITIETIRMYADRSSLEIFINDGALVMTEIIFPNAPYSQLET
DGFQKKGKIHYLTSIWNH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory