SitesBLAST
Comparing Echvi_2807 FitnessBrowser__Cola:Echvi_2807 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q96TU3 Extracellular exo-inulinase inuE; EC 3.2.1.80 from Aspergillus awamori (Black koji mold) (see 2 papers)
30% identity, 79% coverage: 113:547/548 of query aligns to 22:536/537 of Q96TU3
- N67 (= N158) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N111 (≠ Q197) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N300 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N398 (= N430) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N430 (≠ K449) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Sites not aligning to the query:
1y9gA Crystal structure of exo-inulinase from aspergillus awamori complexed with fructose (see paper)
30% identity, 79% coverage: 113:547/548 of query aligns to 3:517/517 of 1y9gA
- active site: D22 (= D132), E222 (= E302)
- binding beta-D-fructofuranose: N21 (= N131), D22 (= D132), Q38 (= Q148), W46 (= W156), F83 (= F188), S84 (= S189), R169 (= R257), D170 (= D258), E222 (= E302), Y294 (= Y354), W316 (vs. gap)
6s2bA Structure of beta-fructofuranosidase from schwanniomyces occidentalis complexed with fructosyl-erythritol (see paper)
40% identity, 51% coverage: 115:395/548 of query aligns to 10:315/512 of 6s2bA
- active site: A27 (≠ D132), E207 (= E302)
- binding (2~{S},3~{R})-4-[(2~{R},3~{S},4~{S},5~{R})-2,5-bis(hydroxymethyl)-3,4-bis(oxidanyl)oxolan-2-yl]oxybutane-1,2,3-triol: N26 (= N131), Q45 (= Q148), W53 (= W156), F87 (= F188), S88 (= S189), R155 (= R257), D156 (= D258), E207 (= E302), Y270 (= Y354), W291 (vs. gap)
6s1tA Structure of beta-fructofuranosidase from schwanniomyces occidentalis complexed with sucrose (see paper)
40% identity, 51% coverage: 115:395/548 of query aligns to 10:315/512 of 6s1tA
- active site: A27 (≠ D132), E207 (= E302)
- binding beta-D-fructofuranose: N26 (= N131), Q45 (= Q148), F87 (= F188), S88 (= S189), R155 (= R257), D156 (= D258), E207 (= E302), Y270 (= Y354)
- binding alpha-D-glucopyranose: W53 (= W156), E207 (= E302), W291 (vs. gap)
O94220 Extracellular endo-inulinase inu2; 2,1-beta-D-fructanfructanohydrolase; Inulase; EC 3.2.1.7 from Aspergillus ficuum (see 2 papers)
29% identity, 78% coverage: 118:544/548 of query aligns to 29:514/516 of O94220
- M41 (≠ I130) mutation to A: Decreases catalytic activity.
- N42 (= N131) mutation to G: Strongly decreases catalytic activity.
- E43 (≠ D132) mutation to D: Strongly decreases catalytic activity.
- Q59 (= Q148) mutation to A: Impairs catalytic activity.
- N61 (= N150) binding
- P62 (= P151) mutation to G: Impairs catalytic activity.
- W67 (= W156) mutation to A: Impairs catalytic activity.
- I70 (≠ M159) mutation to A: Decreases catalytic activity.
- F99 (= F188) mutation to A: Strongly decreases catalytic activity.
- R175 (= R257) mutation to A: Impairs catalytic activity.
- D176 (= D258) binding
- N265 (≠ S326) mutation to A: Decreases catalytic activity.
- R295 (vs. gap) mutation to A: Decreases catalytic activity.
- D298 (≠ Y354) mutation to A: Decreases catalytic activity.
- N320 (≠ G371) binding
- N372 (≠ D423) modified: carbohydrate, N-linked (GlcNAc...) asparagine
3rwkX First crystal structure of an endo-inulinase, from aspergillus ficuum: structural analysis and comparison with other gh32 enzymes. (see paper)
29% identity, 78% coverage: 118:544/548 of query aligns to 6:491/493 of 3rwkX
- binding beta-D-fructofuranose: W17 (= W129), M18 (≠ I130), N19 (= N131), E20 (≠ D132), N38 (= N150), F76 (= F188), T77 (≠ S189), R152 (= R257), D153 (= D258), E210 (= E302), N297 (≠ G371), G300 (≠ Q374)
- binding alpha-D-mannopyranose: G241 (≠ A325), N242 (≠ S326), R272 (vs. gap), R272 (vs. gap), S298 (≠ W372), D417 (≠ N473), P418 (≠ K474), P418 (≠ K474), A419 (≠ L475)
8beqA Structure of fructofuranosidase from rhodotorula dairenensis (see paper)
37% identity, 51% coverage: 113:389/548 of query aligns to 30:329/534 of 8beqA
Sites not aligning to the query:
8besA Structure of d188a-fructofuranosidase from rhodotorula dairenensis in complex with fructose (see paper)
36% identity, 51% coverage: 113:389/548 of query aligns to 28:327/526 of 8besA
Sites not aligning to the query:
8betA Structure of d188a-fructofuranosidase from rhodotorula dairenesis in complex with sucrose (see paper)
36% identity, 51% coverage: 113:389/548 of query aligns to 28:327/525 of 8betA
- binding beta-D-fructofuranose: N46 (= N131), Q64 (= Q148), Q75 (≠ M159), S106 (= S189), R170 (= R257), D171 (= D258), E221 (= E302)
- binding alpha-D-glucopyranose: F105 (= F188), E221 (= E302), N246 (vs. gap)
- binding alpha-D-mannopyranose: P92 (= P176), Y151 (≠ K234), S316 (≠ P378), A317 (≠ G379)
Sites not aligning to the query:
P00724 Invertase 2; Beta-fructofuranosidase 2; Saccharase; EC 3.2.1.26 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
34% identity, 66% coverage: 114:472/548 of query aligns to 24:395/532 of P00724
- D42 (= D132) active site; mutation to N: Loss of activity.
- N64 (≠ Y152) modified: carbohydrate, N-linked (GlcNAc...) asparagine; partial
- N97 (≠ L184) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N111 (≠ Q197) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N118 (= N203) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N165 (= N252) modified: carbohydrate, N-linked (GlcNAc...) asparagine; partial
- N266 (= N335) modified: carbohydrate, N-linked (GlcNAc...) asparagine; partial
- N275 (≠ G344) modified: carbohydrate, N-linked (GlcNAc...) asparagine; partial
- N356 (≠ E434) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N369 (≠ R447) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N384 (≠ G462) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Sites not aligning to the query:
- 1:19 signal peptide
- 23 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 398 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 512 modified: carbohydrate, N-linked (GlcNAc...) asparagine; partial
O33833 Beta-fructosidase; Invertase; Sucrase; EC 3.2.1.26 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
37% identity, 50% coverage: 118:392/548 of query aligns to 3:283/432 of O33833
- E190 (= E302) mutation to A: Loss of activity.; mutation to D: Reduced activity.
1w2tB Beta-fructosidase from thermotoga maritima in complex with raffinose (see paper)
36% identity, 50% coverage: 118:392/548 of query aligns to 3:283/432 of 1w2tB
- active site: D17 (= D132), D190 (≠ E302)
- binding beta-D-fructofuranose: N16 (= N131), D17 (= D132), Q33 (= Q148), F74 (= F188), S75 (= S189), D138 (= D258), D190 (≠ E302), Y240 (= Y354)
- binding alpha-D-glucopyranose: R137 (= R257), T208 (≠ Y323), W260 (vs. gap)
1w2tA Beta-fructosidase from thermotoga maritima in complex with raffinose (see paper)
36% identity, 50% coverage: 118:392/548 of query aligns to 3:283/432 of 1w2tA
7vcpA Frischella perrara beta-fructofuranosidase in complex with fructose (see paper)
29% identity, 72% coverage: 119:512/548 of query aligns to 27:453/490 of 7vcpA
7bwcA Bombyx mori gh32 beta-fructofuranosidase bmsuc1 mutant d63a in complex with sucrose (see paper)
35% identity, 50% coverage: 101:372/548 of query aligns to 12:289/464 of 7bwcA
Sites not aligning to the query:
2aeyA Crystal structure of fructan 1-exohydrolase iia from cichorium intybus in complex with 2,5 dideoxy-2,5-immino-d-mannitol (see paper)
30% identity, 54% coverage: 118:414/548 of query aligns to 7:336/537 of 2aeyA
2addA Crystal structure of fructan 1-exohydrolase iia from cichorium intybus in complex with sucrose (see paper)
30% identity, 54% coverage: 118:414/548 of query aligns to 7:336/537 of 2addA
6nunA Structure of gh32 hydrolase from bifidobacterium adolescentis in complex with frutose
29% identity, 71% coverage: 119:508/548 of query aligns to 39:474/516 of 6nunA
3pijB Beta-fructofuranosidase from bifidobacterium longum - complex with fructose (see paper)
27% identity, 74% coverage: 105:508/548 of query aligns to 25:476/526 of 3pijB
- active site: D54 (= D132), E235 (= E302)
- binding beta-D-fructofuranose: N53 (= N131), D54 (= D132), Q70 (= Q148), M81 (= M159), F113 (= F188), S114 (= S189), R180 (= R257), D181 (= D258), E235 (= E302), Y302 (= Y354)
Q39041 Acid beta-fructofuranosidase 4, vacuolar; At beta fruct4; AtBETAFRUCT4; Acid invertase 4; AI 4; Acid sucrose hydrolase 4; Vacuolar invertase 4; Inv-V4; VAC-INV 4; VI 4; EC 3.2.1.26 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
30% identity, 54% coverage: 118:414/548 of query aligns to 121:452/664 of Q39041
Sites not aligning to the query:
- 2 mutation Missing: No effect on localization.
- 3 mutation Missing: Partial retention in the endoplasmic reticulum.
- 3:4 mutation Missing: Endoplasmic reticulum localization.
- 4 mutation Missing: Partial retention in the endoplasmic reticulum.
- 5 mutation Missing: Endoplasmic reticulum localization.
- 6 mutation Missing: No effect on localization.
- 7 mutation Missing: Partial retention in the endoplasmic reticulum.
- 7:8 Critical for endoplasmic reticulum export; LL→AA: Reduced vacuolar trafficking.; mutation Missing: Endoplasmic reticulum localization.
- 8 mutation Missing: Partial retention in the endoplasmic reticulum.
- 9 P→A: Partial retention in the endoplasmic reticulum.
- 9:10 Critical for endoplasmic reticulum export; PI→AA: Reduced vacuolar trafficking.
- 10 mutation Missing: Endoplasmic reticulum localization.
- 11 mutation Missing: Endoplasmic reticulum localization.
- 12 mutation Missing: No effect on localization.
- 14:16 Critical for trafficking from the trans-Golgi network to the prevacuolar compartment and from the prevacuolar compartment to the central vacuole; EEE→AAA: Reduced vacuolar trafficking.
- 18:21 LCPY→AAAA: Reduced vacuolar trafficking.
- 21:24 YTRL→AAAA: Reduced vacuolar trafficking.; mutation Missing: No effect on localization.
Query Sequence
>Echvi_2807 FitnessBrowser__Cola:Echvi_2807
MIKHPQNILLVVLLLLTCHFTVLASEIELKITKRYLNFPISGQEARHKMTFQSEGQPELN
IVIRLAAGEPDYWVFKDVSNLIGKTLTISYEGNQAGLSKIYQADEIAGADSLYQEQNRPQ
FHFTTRRGWINDPNGLLYYDGEYHLFYQHNPYEREWENMHWGHAVSNDLIHWKELPDALY
PDELGTMFSGSAVIDDQNTAGWNSGSTPAMVAAYTAANRDRQTQGIAYSLDKGKTFTKYE
GNPVIDSKEKWNSIDTRDPKVFWYEPGNHWVMVLNERDGHSIYNSSDLKNWEYQSHTTGF
WECPELFELPVDGNTDEMHWVMYGASGTYMLGEFNGKTFTPTTGKHHYITGSIYAAQTFT
NVPNGRRIQMGWGQISHPGMPFTGMMMLPTELTLRTTKDGPRLFNEPVKETENLFIPIGQ
WRDLTAEEANKILEAHSAKSTLRIRTRIKLSHATSAGISLSGQRILNYDLNYNKLNGAFY
SPNDPTEMGISADIYIDKTSIEIFVDDGAFTVVMPRETVEKNNEHLRFWGNNISIQSLEI
LDVASIWK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory