Comparing Echvi_2827 FitnessBrowser__Cola:Echvi_2827 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xf4A Crystal structure of salmonella enterica serovar typhimurium ycbl (see paper)
38% identity, 97% coverage: 2:211/217 of query aligns to 1:208/210 of 2xf4A
7ev5A Crystal structure of bleg-1 b3 metallo-beta-lactamase (see paper)
40% identity, 94% coverage: 9:211/217 of query aligns to 7:207/209 of 7ev5A
2zwrB Crystal structure of ttha1623 from thermus thermophilus hb8 (see paper)
40% identity, 97% coverage: 2:211/217 of query aligns to 1:200/207 of 2zwrB
2zziA Crystal structure of ttha1623 in a di-iron-bound form (see paper)
41% identity, 94% coverage: 8:211/217 of query aligns to 5:198/198 of 2zziA
7l0bA Crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme (see paper)
31% identity, 97% coverage: 2:211/217 of query aligns to 2:200/202 of 7l0bA
O95571 Persulfide dioxygenase ETHE1, mitochondrial; Ethylmalonic encephalopathy protein 1; Hepatoma subtracted clone one protein; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Homo sapiens (Human) (see 4 papers)
31% identity, 89% coverage: 17:209/217 of query aligns to 38:213/254 of O95571
Sites not aligning to the query:
4chlB Human ethylmalonic encephalopathy protein 1 (hethe1) (see paper)
31% identity, 89% coverage: 17:209/217 of query aligns to 22:197/237 of 4chlB
5ve5A Crystal structure of persulfide dioxygenase rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans in complex with glutathione (see paper)
31% identity, 90% coverage: 17:212/217 of query aligns to 19:197/350 of 5ve5A
Sites not aligning to the query:
Q9C8L4 Persulfide dioxygenase ETHE1 homolog, mitochondrial; Glyoxalase II; Glx II; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 93% coverage: 16:216/217 of query aligns to 66:257/294 of Q9C8L4
2gcuA X-ray structure of gene product from arabidopsis thaliana at1g53580 (see paper)
30% identity, 92% coverage: 17:216/217 of query aligns to 18:208/244 of 2gcuA
6sg9FL uS3m (see paper)
25% identity, 92% coverage: 10:208/217 of query aligns to 60:294/320 of 6sg9FL
Sites not aligning to the query:
Q9SID3 Hydroxyacylglutathione hydrolase 2, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
30% identity, 82% coverage: 17:195/217 of query aligns to 85:239/324 of Q9SID3
2q42A Ensemble refinement of the protein crystal structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 (see paper)
30% identity, 83% coverage: 16:195/217 of query aligns to 14:169/254 of 2q42A
4ysbA Crystal structure of ethe1 from myxococcus xanthus (see paper)
28% identity, 93% coverage: 16:216/217 of query aligns to 15:195/225 of 4ysbA
3tp9A Crystal structure of alicyclobacillus acidocaldarius protein with beta-lactamase and rhodanese domains
29% identity, 86% coverage: 22:208/217 of query aligns to 24:223/473 of 3tp9A
5wcmA Crystal structure of the complex between class b3 beta-lactamase bjp-1 and 4-nitrobenzene-sulfonamide - new refinement (see paper)
38% identity, 38% coverage: 56:138/217 of query aligns to 66:149/263 of 5wcmA
Sites not aligning to the query:
5nggA Crystal structure of the subclass b3 metallo-beta-lactamase bjp-1 in complex with acetate anion
37% identity, 38% coverage: 56:138/217 of query aligns to 77:160/274 of 5nggA
Sites not aligning to the query:
4efzA Crystal structure of a hypothetical metallo-beta-lactamase from burkholderia pseudomallei
24% identity, 82% coverage: 17:195/217 of query aligns to 20:216/295 of 4efzA
2p18A Crystal structure of the leishmania infantum glyoxalase ii (see paper)
35% identity, 49% coverage: 56:162/217 of query aligns to 64:162/283 of 2p18A
Sites not aligning to the query:
8ewoA Crystal structure of putative glyoxylase ii from pseudomonas aeruginosa
36% identity, 38% coverage: 114:195/217 of query aligns to 92:171/259 of 8ewoA
Sites not aligning to the query:
>Echvi_2827 FitnessBrowser__Cola:Echvi_2827
MLNVQTFTFNPFQENCYVLYDDTKEAVIIDPGCYAKEEQETLKQFLQSNDLRPVRLLNTH
CHIDHVLGNFFINQNYGLPLEIHPKDEPVLMAVGSYASNYGFPAYTPCKAEKYLEEGDKV
TFGETDLEVIWVPGHAPGHVVFYHPESKTCIGGDTLFQGSIGRTDLPGGDHQTLLDAIKA
KLFTLPDDVKVHPGHGPATLIGHEKIHNPFVGKNAQF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory