Comparing Echvi_2833 FitnessBrowser__Cola:Echvi_2833 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
4rqoB Crystal structure of l-serine dehydratase from legionella pneumophila (see paper)
43% identity, 28% coverage: 6:69/225 of query aligns to 4:71/448 of 4rqoB
Sites not aligning to the query:
>Echvi_2833 FitnessBrowser__Cola:Echvi_2833
MTRKSSVFDMIGPVMIGPSSSHTAGVVRIARAAIKVLGGIPDDAVITFYNSFARTYEGHG
SDKAIIGGLMDLKTDDARIKQAFELAEARGLTYIFKSVGNASVFHPNTIKLNLTKGDRKV
EVIGESLGGGLINIKSIDGFHAEFSAQEHTLIIKADDVSGAIAFITSILAQEQANIATMS
VSRKGKRDMACHVIEMDSGLNAITIKYLESISWIHELIYIPDIDL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory