SitesBLAST
Comparing Echvi_2865 FitnessBrowser__Cola:Echvi_2865 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7xreC Crystal structure of dgpa
27% identity, 37% coverage: 88:271/492 of query aligns to 33:213/363 of 7xreC
- binding nicotinamide-adenine-dinucleotide: D38 (= D93), I39 (≠ V94), T78 (= T135), P79 (= P136), N80 (≠ D137), H83 (= H140), E100 (= E157), K101 (= K158), P102 (= P159), F170 (≠ N227), Q176 (vs. gap), H187 (≠ D239)
Sites not aligning to the query:
7xr9A Crystal structure of dgpa with glucose (see paper)
29% identity, 32% coverage: 116:271/492 of query aligns to 51:203/344 of 7xr9A
- binding beta-D-glucopyranose: K91 (= K158), R150 (≠ G217), W157 (= W224), F160 (≠ N227), D173 (≠ E235), H177 (≠ D239)
- binding nicotinamide-adenine-dinucleotide: D51 (= D116), Y52 (≠ F117), C67 (≠ A134), T68 (= T135), P69 (= P136), H73 (= H140), E90 (= E157), K91 (= K158), P92 (= P159), Q119 (= Q186), V159 (= V226), F160 (≠ N227), Q166 (vs. gap)
Sites not aligning to the query:
3q2kC Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
26% identity, 38% coverage: 57:243/492 of query aligns to 3:195/347 of 3q2kC
- active site: K100 (= K158), H188 (≠ T236)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R17 (≠ N71), K100 (= K158), W159 (≠ G217), T160 (≠ R218), R161 (= R219), Y165 (vs. gap), N184 (≠ P232), Q185 (≠ A233), H188 (≠ T236)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G70), R17 (≠ N71), I18 (≠ R72), D40 (= D93), T41 (≠ V94), A76 (= A134), T77 (= T135), S79 (≠ D137), H82 (= H140), Q85 (≠ V143), E99 (= E157), K100 (= K158), Q128 (= Q186), W171 (= W221), R172 (≠ H222)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 243, 244
3q2kK Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
26% identity, 37% coverage: 61:243/492 of query aligns to 2:190/322 of 3q2kK
- active site: K95 (= K158), H183 (≠ T236)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R12 (≠ N71), K95 (= K158), T155 (≠ R218), R156 (= R219), Y160 (vs. gap), N179 (≠ P232), Q180 (≠ A233), H183 (≠ T236)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G68), G11 (= G70), R12 (≠ N71), I13 (≠ R72), D35 (= D93), T36 (≠ V94), T72 (= T135), P73 (= P136), S74 (≠ D137), L76 (≠ S139), H77 (= H140), E94 (= E157), K95 (= K158), Q123 (= Q186), W166 (= W221), R167 (≠ H222), H183 (≠ T236)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 239
6t2bB Glycoside hydrolase family 109 from akkermansia muciniphila in complex with galnac and NAD+.
27% identity, 30% coverage: 61:208/492 of query aligns to 33:185/439 of 6t2bB
- binding nicotinamide-adenine-dinucleotide: G40 (= G68), G43 (≠ N71), R44 (= R72), D65 (= D93), L66 (≠ V94), D93 (= D116), S111 (≠ A134), T112 (= T135), W114 (≠ D137), H117 (= H140), E134 (= E157), V135 (≠ K158), N163 (≠ M183)
Sites not aligning to the query:
3m2tA The crystal structure of dehydrogenase from chromobacterium violaceum
29% identity, 25% coverage: 62:184/492 of query aligns to 4:123/342 of 3m2tA
- binding nicotinamide-adenine-dinucleotide: G10 (= G68), G12 (= G70), A13 (≠ N71), Q14 (≠ R72), D36 (= D93), S37 (≠ V94), R41 (≠ K107), A73 (= A134), G74 (≠ T135), L78 (≠ S139), E96 (= E157), K97 (= K158)
Sites not aligning to the query:
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
25% identity, 29% coverage: 65:208/492 of query aligns to 8:149/342 of 3ceaA
- active site: K98 (= K158)
- binding nicotinamide-adenine-dinucleotide: G11 (= G68), G13 (= G70), R14 (≠ N71), L15 (≠ R72), L38 (≠ V94), Q42 (≠ H100), V74 (≠ A134), A75 (≠ T135), P76 (= P136), T77 (≠ D137), F79 (≠ S139), H80 (= H140), M83 (≠ V143), E97 (= E157), K98 (= K158), M127 (≠ Q186)
Sites not aligning to the query:
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
29% identity, 24% coverage: 97:214/492 of query aligns to 46:158/336 of 5a06A
- active site: K101 (= K158)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y59 (≠ F114), I77 (≠ A134), T78 (= T135), P79 (= P136), N80 (≠ D137), L82 (≠ S139), H83 (= H140), E100 (= E157), K101 (= K158), R129 (≠ Q186)
- binding sorbitol: D72 (= D129), H96 (≠ G153), K101 (= K158), R122 (≠ V179), R122 (≠ V179), L124 (≠ T181)
Sites not aligning to the query:
- active site: 186
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 11, 12, 13, 14, 36, 37, 38, 41, 168, 169, 186, 264
- binding sorbitol: 2, 160, 169, 182, 186, 287, 296, 299, 306, 310, 311
5a03C Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
29% identity, 24% coverage: 97:214/492 of query aligns to 46:158/336 of 5a03C
Sites not aligning to the query:
- active site: 186
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 10, 11, 12, 13, 14, 36, 37, 38, 41, 168, 169, 186, 264
- binding beta-D-xylopyranose: 160, 169, 182, 186
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
29% identity, 24% coverage: 97:214/492 of query aligns to 45:157/335 of 5a05A
Sites not aligning to the query:
- active site: 185
- binding beta-D-glucopyranose: 159, 181, 185
- binding alpha-D-glucopyranose: 259, 262
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 9, 10, 11, 12, 13, 35, 36, 37, 40, 167, 168, 185, 263
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
29% identity, 24% coverage: 97:214/492 of query aligns to 45:157/335 of 5a04A
Sites not aligning to the query:
- active site: 185
- binding beta-D-glucopyranose: 159, 168, 181, 185
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 10, 11, 12, 13, 35, 36, 37, 40, 167, 168, 185, 263
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
29% identity, 24% coverage: 97:214/492 of query aligns to 45:157/335 of 5a03E
Sites not aligning to the query:
- active site: 185
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 9, 10, 11, 12, 13, 35, 36, 37, 40, 167, 168, 185, 263
- binding beta-D-xylopyranose: 159, 168, 181, 185, 205, 207, 209
- binding alpha-D-xylopyranose: 268, 279, 280
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
29% identity, 24% coverage: 97:214/492 of query aligns to 45:157/335 of 5a02A
Sites not aligning to the query:
- active site: 185
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 10, 11, 12, 13, 35, 36, 37, 40, 167, 168, 185, 263
7d5nB Crystal structure of inositol dehydrogenase homolog complexed with nadh and myo-inositol from azotobacter vinelandii
41% identity, 12% coverage: 114:174/492 of query aligns to 67:130/389 of 7d5nB
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K114 (= K158)
- binding 1,4-dihydronicotinamide adenine dinucleotide: T91 (= T135), P92 (= P136), N93 (≠ D137), H96 (= H140), E113 (= E157), K114 (= K158)
Sites not aligning to the query:
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: 143, 190, 204, 208
- binding 1,4-dihydronicotinamide adenine dinucleotide: 17, 19, 22, 23, 24, 46, 47, 189, 190, 208, 332
7d5nA Crystal structure of inositol dehydrogenase homolog complexed with nadh and myo-inositol from azotobacter vinelandii
41% identity, 12% coverage: 114:174/492 of query aligns to 67:130/379 of 7d5nA
Sites not aligning to the query:
- binding 1,4-dihydronicotinamide adenine dinucleotide: 17, 19, 22, 23, 24, 46, 47, 185, 186, 199, 323
7d5mA Crystal structure of inositol dehydrogenase homolog complexed with NAD+ from azotobacter vinelandii
41% identity, 12% coverage: 114:174/492 of query aligns to 68:131/389 of 7d5mA
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 18, 20, 23, 24, 25, 47, 48, 190, 191, 209, 333
3dtyA Crystal structure of an oxidoreductase from pseudomonas syringae
31% identity, 21% coverage: 114:216/492 of query aligns to 63:166/374 of 3dtyA
Sites not aligning to the query:
6z3cAAA Gfo/Idh/MocA family oxidoreductase (see paper)
25% identity, 33% coverage: 62:221/492 of query aligns to 12:161/379 of 6z3cAAA
- binding nicotinamide-adenine-dinucleotide: G20 (= G70), Y21 (≠ N71), F22 (≠ R72), L42 (≠ C92), D43 (= D93), P44 (≠ V94), A77 (= A134), T78 (= T135), P79 (= P136), N80 (≠ D137), H83 (= H140), E100 (= E157), K101 (= K158), V129 (≠ Q186)
Sites not aligning to the query:
3nt5A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor and product inosose (see paper)
27% identity, 32% coverage: 62:216/492 of query aligns to 3:157/337 of 3nt5A
- active site: K97 (= K158)
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K97 (= K158), H155 (= H214)
- binding nicotinamide-adenine-dinucleotide: G9 (= G68), G11 (= G70), A12 (≠ N71), I13 (≠ R72), D35 (= D93), V36 (= V94), S74 (≠ T135), W75 (≠ P136), G76 (≠ D137), E96 (= E157), K97 (= K158)
Sites not aligning to the query:
3nt4A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadh and inositol (see paper)
27% identity, 32% coverage: 62:216/492 of query aligns to 3:157/337 of 3nt4A
- active site: K97 (= K158)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: H155 (= H214)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G70), A12 (≠ N71), I13 (≠ R72), D35 (= D93), V36 (= V94), S74 (≠ T135), W75 (≠ P136), G76 (≠ D137), E96 (= E157), K97 (= K158)
Sites not aligning to the query:
Query Sequence
>Echvi_2865 FitnessBrowser__Cola:Echvi_2865
MKTEKNKVLQKAGERRDFLKKSALALGAVSIVPSHVLFSKPEIRDKQGKLLRKASFVPSD
RVNLACVGIGNRGEQVINAIDETGQANIVTLCDVDMGAEHTLPSMNKFPKATRFQDFREM
LDKDSQHFDAVMVATPDFSHFPVTMAAMAAGKGVYVEKPLARTFHEIELLMKAAEKYGVV
TQMGNQGHSEANYFQFKAWVDAGIIKDVTAITCHMNGRRRWHGWDVNMGKFPAAETIPDT
LDWDTWLTTAQHHDYNHDFINGQWRCWYDFGMGALGDWGAHIMDTFHQFLDLGLPYEVDP
VKIEGHNALFYPQATTLDFKFPKRGKMPEVNVSWYDGLDNIPEVPEGYGSSELDADIPAA
SNGKIQPAKLNPGKIIYGKELTFKGGSHGSTLSIIPDEKAKAMEGKLPEVPESPSNHFAN
FLLACKGEEKTRSPFSIAGPLSQVFTLGTLAQRLNAKLEFDRDKKVITNNKFANALLVGP
PPRKGWETYYKV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory