Comparing Echvi_2909 FitnessBrowser__Cola:Echvi_2909 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
47% identity, 100% coverage: 1:218/218 of query aligns to 3:219/223 of 2pclA
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
47% identity, 93% coverage: 16:218/218 of query aligns to 24:226/233 of P75957
7mdyC Lolcde nucleotide-bound
47% identity, 93% coverage: 16:218/218 of query aligns to 21:223/226 of 7mdyC
Sites not aligning to the query:
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
47% identity, 93% coverage: 16:218/218 of query aligns to 23:225/229 of 7v8iD
7arlD Lolcde in complex with lipoprotein and adp (see paper)
47% identity, 93% coverage: 16:217/218 of query aligns to 21:222/222 of 7arlD
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
45% identity, 99% coverage: 1:216/218 of query aligns to 4:222/648 of P75831
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
41% identity, 100% coverage: 1:218/218 of query aligns to 3:223/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
41% identity, 100% coverage: 1:218/218 of query aligns to 3:223/592 of 5lj7A
8g4cB Bceabs atpgs high res tm (see paper)
41% identity, 100% coverage: 1:218/218 of query aligns to 3:224/248 of 8g4cB
7tchB Bceab e169q variant atp-bound conformation (see paper)
41% identity, 100% coverage: 1:218/218 of query aligns to 2:223/245 of 7tchB
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
40% identity, 100% coverage: 1:218/218 of query aligns to 1:226/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
39% identity, 100% coverage: 1:218/218 of query aligns to 1:226/230 of 1l2tA
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
39% identity, 100% coverage: 1:218/218 of query aligns to 3:223/226 of 5xu1B
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
40% identity, 94% coverage: 14:218/218 of query aligns to 21:224/650 of 5ws4A
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
41% identity, 100% coverage: 1:218/218 of query aligns to 2:217/241 of 4u00A
P9WQK5 Uncharacterized ABC transporter ATP-binding protein Rv0073 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
39% identity, 93% coverage: 9:210/218 of query aligns to 12:215/330 of P9WQK5
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
39% identity, 100% coverage: 1:218/218 of query aligns to 1:217/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
40% identity, 100% coverage: 1:218/218 of query aligns to 3:219/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
40% identity, 100% coverage: 1:218/218 of query aligns to 3:219/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
40% identity, 100% coverage: 1:218/218 of query aligns to 3:219/242 of 2olkA
>Echvi_2909 FitnessBrowser__Cola:Echvi_2909
MLRAKGIHKYYGDLHVLKGVDVEIAAGEIVSIVGASGAGKSTLLHILGTLDDADKGLVSI
DDKSLTALKGDKLAAYRNQEVGFIFQFHNLLPEFTAEENIIIPGLIAKKDEKYLTEKAKE
LARLLGIMDRLGHKPSELSGGEQQRVAVARALINDPKIIFADEPSGNLDTQSAESLHELF
FTLRDRFGQSFVIVTHNQQLAQMADRMLTMQDGVIVSE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory