Comparing Echvi_2919 Echvi_2919 Ornithine/acetylornithine aminotransferase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4uoxA Crystal structure of ygjg in complex with pyridoxal-5'-phosphate and putrescine (see paper)
39% identity, 91% coverage: 35:392/393 of query aligns to 74:452/453 of 4uoxA
Sites not aligning to the query:
P42588 Putrescine aminotransferase; PAT; PATase; Cadaverine transaminase; Diamine transaminase; Putrescine transaminase; Putrescine--2-oxoglutaric acid transaminase; Putrescine:2-OG aminotransferase; EC 2.6.1.82; EC 2.6.1.29 from Escherichia coli (strain K12) (see paper)
39% identity, 91% coverage: 35:392/393 of query aligns to 80:458/459 of P42588
4uoxC Crystal structure of ygjg in complex with pyridoxal-5'-phosphate and putrescine (see paper)
39% identity, 91% coverage: 35:392/393 of query aligns to 78:456/456 of 4uoxC
Sites not aligning to the query:
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
34% identity, 94% coverage: 19:386/393 of query aligns to 10:371/375 of 2eh6A
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
34% identity, 94% coverage: 19:386/393 of query aligns to 11:372/376 of O66442
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
36% identity, 93% coverage: 23:386/393 of query aligns to 31:390/395 of Q5SHH5
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
36% identity, 94% coverage: 21:390/393 of query aligns to 19:389/390 of 8ht4B
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
36% identity, 93% coverage: 23:386/393 of query aligns to 23:382/387 of 1wkhA
Sites not aligning to the query:
1wkgA Acetylornithine aminotransferase from thermus thermophilus hb8
36% identity, 93% coverage: 23:386/393 of query aligns to 23:382/387 of 1wkgA
Sites not aligning to the query:
1vefA Acetylornithine aminotransferase from thermus thermophilus hb8
36% identity, 93% coverage: 23:386/393 of query aligns to 23:382/387 of 1vefA
Sites not aligning to the query:
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
35% identity, 93% coverage: 26:390/393 of query aligns to 17:385/385 of Q9X2A5
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
35% identity, 93% coverage: 26:390/393 of query aligns to 25:393/393 of 2ordA
3nx3A Crystal structure of acetylornithine aminotransferase (argd) from campylobacter jejuni
34% identity, 92% coverage: 21:381/393 of query aligns to 13:376/388 of 3nx3A
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 94% coverage: 21:390/393 of query aligns to 78:453/457 of Q9M8M7
Sites not aligning to the query:
O50131 Ornithine aminotransferase; Orn-AT; Ornithine delta-aminotransferase; EC 2.6.1.13 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see paper)
36% identity, 97% coverage: 11:390/393 of query aligns to 26:442/454 of O50131
7vo1A Structure of aminotransferase-substrate complex (see paper)
36% identity, 97% coverage: 11:390/393 of query aligns to 24:440/452 of 7vo1A
7vntA Structure of aminotransferase-substrate complex (see paper)
36% identity, 97% coverage: 11:390/393 of query aligns to 24:440/452 of 7vntA
7vnoA Structure of aminotransferase (see paper)
36% identity, 97% coverage: 11:390/393 of query aligns to 24:440/452 of 7vnoA
A0QYS9 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
36% identity, 92% coverage: 21:380/393 of query aligns to 20:373/390 of A0QYS9
4jevB N-acetylornithine aminotransferase from s. Typhimurium complexed with gabaculine
33% identity, 93% coverage: 25:390/393 of query aligns to 25:395/402 of 4jevB
>Echvi_2919 Echvi_2919 Ornithine/acetylornithine aminotransferase
MNNRQLFLSNLAQTTDFPLLIEIEKAEGIYMYGPKGEKYIDLISGIGVSNVGHRHPKVLK
AIQDQLDKYMHLMVYGEYVQSPQTQLAKALTDTLPKKLDNVYLVNSGSEAVEGALKLAKR
YTGRREILSCVNAYHGSSHGALSVGGNEIFKRAYRPLLPGIRHLDFNEPDQLDQITEETA
AIMVETVQGEAGIRVGTKEYFKALRHRCDETGTLLILDEIQAGFGRTGKFWAFQHYDIVP
DIVVCAKGMGGGMPIGAFIAPQSIMSVFKNNPLLGHITTFGGHPVSCAAALATIDILRDE
KLIQHVERKANLFKKHLNHPKIQEIRNKGLMMAVKFEAFEVLKPIIDRAIELGIITDWFL
FCEDSMRIAPPLTITDEEIEKACAIILQSIDEN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory