Comparing Echvi_2937 FitnessBrowser__Cola:Echvi_2937 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
7bywA Crystal structure of acidovorax avenae l-fucose mutarotase (l-fucose- bound form) (see paper)
29% identity, 98% coverage: 3:110/110 of query aligns to 1:107/108 of 7bywA
>Echvi_2937 FitnessBrowser__Cola:Echvi_2937
MTKRYTMALDLKDDPTLIAEYEKFHQAVWPEIQKSIKDAGIEVMEIYRWENRLFMIMETT
EDFSFEKKAAMDAANPKVREWEDLMWTYQQGLPGVPEGEKWQVMNKIFEL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory