SitesBLAST
Comparing Echvi_2940 FitnessBrowser__Cola:Echvi_2940 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
37% identity, 98% coverage: 1:246/251 of query aligns to 5:252/255 of 5itvA
- active site: G18 (= G14), S141 (= S135), Y154 (= Y148), K158 (= K152)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G10), S17 (= S13), G18 (= G14), I19 (= I15), D38 (= D34), I39 (≠ Y35), T61 (≠ G59), I63 (≠ V61), N89 (= N84), G91 (= G86), T139 (≠ M133), S141 (= S135), Y154 (= Y148), K158 (= K152), P184 (= P178), G185 (= G179), I186 (≠ R180), I187 (≠ V181)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
37% identity, 99% coverage: 1:249/251 of query aligns to 4:249/249 of 4bmsF
- active site: S137 (= S135), H147 (≠ R145), Y150 (= Y148), K154 (= K152), Q195 (≠ N193)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G10), N15 (≠ A12), S16 (= S13), I18 (= I15), R38 (≠ Y35), R39 (≠ D36), A59 (≠ G59), D60 (= D60), V61 (= V61), N87 (= N84), S88 (≠ A85), G89 (= G86), V110 (= V107), S137 (= S135), Y150 (= Y148), K154 (= K152), G181 (= G179), I183 (≠ V181), T185 (= T183), I187 (≠ F185)
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
37% identity, 99% coverage: 1:249/251 of query aligns to 4:249/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (= S135), H147 (≠ R145), Y150 (= Y148), L188 (= L190), L246 (≠ F246)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G10), N15 (≠ A12), S16 (= S13), G17 (= G14), I18 (= I15), R38 (≠ Y35), R39 (≠ D36), D60 (= D60), V61 (= V61), N87 (= N84), S88 (≠ A85), G89 (= G86), V110 (= V107), T135 (≠ M133), S137 (= S135), Y150 (= Y148), K154 (= K152), P180 (= P178), G181 (= G179), A182 (≠ R180), I183 (≠ V181), T185 (= T183), S187 (≠ F185)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
34% identity, 98% coverage: 1:246/251 of query aligns to 3:245/248 of 6ixmC
- active site: G16 (= G14), S142 (= S135), Y155 (= Y148), K159 (= K152)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), S15 (= S13), G16 (= G14), I17 (= I15), D36 (= D34), I37 (≠ Y35), A61 (≠ G59), D62 (= D60), T63 (≠ V61), N89 (= N84), A90 (= A85), M140 (= M133), S142 (= S135), Y155 (= Y148), K159 (= K152), P185 (= P178), A186 (≠ G179), Y187 (≠ R180), I188 (≠ V181), L192 (≠ F185)
6xewA Structure of serratia marcescens 2,3-butanediol dehydrogenase (see paper)
37% identity, 97% coverage: 3:245/251 of query aligns to 5:240/251 of 6xewA
- active site: G16 (= G14), S138 (= S135), Y151 (= Y148)
- binding r,3-hydroxybutan-2-one: S138 (= S135), S140 (≠ A137), Y151 (= Y148)
- binding s,3-hydroxybutan-2-one: S138 (= S135), Y151 (= Y148), S182 (≠ G179)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), N15 (≠ S13), G16 (= G14), M17 (≠ I15), D36 (= D34), W37 (≠ Y35), W37 (≠ Y35), A38 (≠ D36), I59 (≠ G59), D60 (= D60), V61 (= V61), N87 (= N84), A88 (= A85), G89 (= G86), V110 (= V107), T136 (≠ M133), S138 (= S135), Y151 (= Y148), K155 (= K152), S182 (≠ G179), L183 (≠ R180), V184 (= V181), T186 (= T183), N187 (≠ P184), M188 (≠ F185), T189 (≠ V186)
H9XP47 Meso-2,3-butanediol dehydrogenase; BDH; meso-2,3-BDH; (R,S)-butane-2,3-diol dehydrogenase; NAD(H)-dependent meso-2,3-BDH; SmBdh; EC 1.1.1.- from Serratia marcescens (see paper)
37% identity, 97% coverage: 3:245/251 of query aligns to 5:240/251 of H9XP47
- N15 (≠ S13) binding
- M17 (≠ I15) binding
- D36 (= D34) binding
- D60 (= D60) binding
- V61 (= V61) binding
- N87 (= N84) binding
- S138 (= S135) binding ; binding
- V139 (= V136) mutation to Q: Retains 50% of activity with acetoin as substrate; when associated with A-247.
- S140 (≠ A137) binding
- Y151 (= Y148) binding ; binding ; binding
- K155 (= K152) binding
- V184 (= V181) binding
- T186 (= T183) binding
- RDK 197:199 (≠ FDK 202:204) mutation to SEAAGKPLGYGTET: Mimics longer alpha6 helix. Retains 3% of activity with acetoin as substrate.
Sites not aligning to the query:
- 247 Q→A: Retains 10% of activity with acetoin as substrate. Retains 50% of activity with acetoin as substrate; when associated with Q-139.
6vspA Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
37% identity, 97% coverage: 3:245/251 of query aligns to 5:240/251 of 6vspA
- active site: G16 (= G14), S138 (= S135), Y151 (= Y148)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), N15 (≠ S13), G16 (= G14), M17 (≠ I15), D36 (= D34), W37 (≠ Y35), W37 (≠ Y35), A38 (≠ D36), I59 (≠ G59), D60 (= D60), V61 (= V61), N87 (= N84), A88 (= A85), G89 (= G86), V90 (≠ I87), V110 (= V107), T136 (≠ M133), S138 (= S135), Y151 (= Y148), K155 (= K152), P181 (= P178), S182 (≠ G179), L183 (≠ R180), V184 (= V181), T186 (= T183), N187 (≠ P184), M188 (≠ F185), T189 (≠ V186)
6vspB Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
37% identity, 97% coverage: 3:245/251 of query aligns to 7:242/252 of 6vspB
7ejiB Crystal structure of kred f147l/l153q/y190p/l199a/m205f/m206f variant and methyl methacrylate complex
37% identity, 98% coverage: 1:246/251 of query aligns to 4:248/251 of 7ejiB
- binding methyl 2-methylprop-2-enoate: S142 (= S135), I143 (≠ V136), Y155 (= Y148), F205 (= F202)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G10), T15 (≠ A12), L16 (≠ S13), G17 (= G14), I18 (= I15), R38 (≠ Y35), H39 (≠ D36), D62 (= D60), A63 (≠ V61), N89 (= N84), A90 (= A85), V112 (= V107), M140 (= M133), S142 (= S135), Y155 (= Y148), K159 (= K152), P187 (= P178), P189 (≠ R180), I190 (≠ V181), T192 (= T183), P193 (= P184), L194 (≠ F185)
7ejhA Crystal structure of kred mutant-f147l/l153q/y190p/l199a/m205f/m206f and 2-hydroxyisoindoline-1,3-dione complex
37% identity, 98% coverage: 1:246/251 of query aligns to 6:250/253 of 7ejhA
- binding 2-oxidanylisoindole-1,3-dione: S144 (= S135), I145 (≠ V136), E146 (≠ A137), Y157 (= Y148), V197 (= V186), F207 (= F202)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G10), T17 (≠ A12), I20 (= I15), R40 (≠ Y35), H41 (≠ D36), D64 (= D60), A65 (≠ V61), N91 (= N84), A92 (= A85), V114 (= V107), M142 (= M133), S144 (= S135), Y157 (= Y148), K161 (= K152), P189 (= P178), G190 (= G179), P191 (≠ R180), I192 (≠ V181), T194 (= T183), P195 (= P184), L196 (≠ F185)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
38% identity, 98% coverage: 1:246/251 of query aligns to 8:250/258 of 4wecA
- active site: G21 (= G14), S143 (= S135), Q154 (≠ R145), Y157 (= Y148), K161 (= K152)
- binding nicotinamide-adenine-dinucleotide: G17 (= G10), A19 (= A12), S20 (= S13), G21 (= G14), I22 (= I15), D41 (= D34), I42 (≠ Y35), V61 (≠ G59), D62 (= D60), V63 (= V61), N89 (= N84), T141 (≠ M133), Y157 (= Y148), K161 (= K152), P187 (= P178), P189 (≠ R180), V190 (= V181)
1zk1A Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
36% identity, 98% coverage: 1:246/251 of query aligns to 4:248/251 of 1zk1A
- active site: G17 (= G14), S142 (= S135), Y155 (= Y148), K159 (= K152)
- binding 1-phenylethanone: A93 (≠ S88), N95 (≠ V90), Y155 (= Y148), Y189 (≠ R180)
- binding nicotinamide-adenine-dinucleotide: G13 (= G10), L16 (≠ S13), I18 (= I15), D37 (= D34), H61 (≠ G59), D62 (= D60), S63 (≠ V61), N89 (= N84), A90 (= A85), I92 (= I87), M140 (= M133), Y155 (= Y148), G188 (= G179), I190 (≠ V181), L194 (≠ F185)
1zjzA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
36% identity, 98% coverage: 1:246/251 of query aligns to 4:248/251 of 1zjzA
- active site: G17 (= G14), S142 (= S135), Y155 (= Y148), K159 (= K152)
- binding nicotinamide-adenine-dinucleotide: G13 (= G10), L16 (≠ S13), I18 (= I15), D37 (= D34), D62 (= D60), N89 (= N84), A90 (= A85), G91 (= G86), I92 (= I87), Y155 (= Y148), G188 (= G179), I190 (≠ V181), L194 (≠ F185)
- binding (1r)-1-phenylethanol: A93 (≠ S88), N95 (≠ V90), L152 (≠ R145), Y155 (= Y148)
1zjyA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nadh (see paper)
36% identity, 98% coverage: 1:246/251 of query aligns to 4:248/251 of 1zjyA
- active site: G17 (= G14), S142 (= S135), Y155 (= Y148), K159 (= K152)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G13 (= G10), L16 (≠ S13), G17 (= G14), I18 (= I15), D37 (= D34), D62 (= D60), N89 (= N84), A90 (= A85), G91 (= G86), I92 (= I87), Y155 (= Y148), G188 (= G179), I190 (≠ V181), L194 (≠ F185)
- binding (1r)-1-phenylethanol: A93 (≠ S88), N95 (≠ V90), L152 (≠ R145), Y155 (= Y148), Y189 (≠ R180)
Q6WVP7 NADP-dependent (R)-specific alcohol dehydrogenase; (R)-specific ADH; Ketoreductase; KRED; EC 1.1.1.- from Lentilactobacillus kefiri (Lactobacillus kefiri) (see paper)
37% identity, 98% coverage: 1:246/251 of query aligns to 5:249/252 of Q6WVP7
Sites not aligning to the query:
1zk4A Structure of r-specific alcohol dehydrogenase (wildtype) from lactobacillus brevis in complex with acetophenone and NADP (see paper)
36% identity, 98% coverage: 1:246/251 of query aligns to 4:248/251 of 1zk4A
- active site: G17 (= G14), S142 (= S135), Y155 (= Y148), K159 (= K152)
- binding 1-phenylethanone: A93 (≠ S88), Y155 (= Y148), Y189 (≠ R180)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G10), T15 (≠ A12), L16 (≠ S13), I18 (= I15), T36 (≠ I33), G37 (≠ D34), R38 (≠ Y35), H61 (≠ G59), D62 (= D60), N89 (= N84), A90 (= A85), G91 (= G86), I92 (= I87), Y155 (= Y148), G188 (= G179), I190 (≠ V181), T192 (= T183), L194 (≠ F185)
6y0sAAA R-specific alcohol dehydrogenase (see paper)
36% identity, 98% coverage: 1:246/251 of query aligns to 4:248/251 of 6y0sAAA
Q8JZV9 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Mus musculus (Mouse) (see paper)
38% identity, 98% coverage: 1:246/251 of query aligns to 4:243/245 of Q8JZV9
- Y147 (= Y148) active site, Proton acceptor; mutation to F: Loss of function.
D4A1J4 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Rattus norvegicus (Rat) (see paper)
38% identity, 98% coverage: 1:246/251 of query aligns to 4:243/245 of D4A1J4
- Y147 (= Y148) mutation to F: Loss of function.
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
36% identity, 98% coverage: 1:245/251 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), M16 (≠ I15), D35 (= D34), I36 (≠ Y35), I62 (≠ V61), N88 (= N84), G90 (= G86), I138 (≠ M133), S140 (= S135), Y152 (= Y148), K156 (= K152), I185 (≠ V181)
Query Sequence
>Echvi_2940 FitnessBrowser__Cola:Echvi_2940
MKNKTILITGGASGIGLAMTKRFAEEGGNVYFIDYDQKTGEKVAEELTSKGHRVTFLQGD
VSQTEEMKQTISSISGSIDVLVNNAGISHVGNLENTAEEDFDRLYQVNVKGIYNCSLASL
PKMKEKGGSIINMASVASTMGLPDRFAYSMTKGAVFSMTLSMARDYVEYNIRVNSIAPGR
VHTPFVDGFLAKNYPGKEKEMFDKLAATQPIGRMGKPEEIAAMAVYLSSDEASFLTGGNY
PIDGGFVNLKM
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory