SitesBLAST
Comparing Echvi_2941 FitnessBrowser__Cola:Echvi_2941 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ip5A Crystal structure of l-fuconate dehydratase from silicibacter sp. Tm1040 liganded with mg and d-erythronohydroxamate
63% identity, 94% coverage: 15:435/448 of query aligns to 2:421/421 of 4ip5A
- active site: K217 (= K231), D245 (= D259), N247 (= N261), E271 (= E285), E298 (= E312), D321 (= D335), H348 (= H362), E379 (= E393)
- binding (2r,3r)-n,2,3,4-tetrahydroxybutanamide: G21 (= G34), D23 (= D36), Y31 (= Y44), K215 (= K229), K217 (= K231), D245 (= D259), N247 (= N261), E298 (= E312), H348 (= H362)
- binding magnesium ion: D245 (= D259), E271 (= E285), E298 (= E312)
4ip4A Crystal structure of l-fuconate dehydratase from silicibacter sp. Tm1040 liganded with mg
63% identity, 94% coverage: 15:435/448 of query aligns to 2:421/421 of 4ip4A
4a35A Crystal structure of human mitochondrial enolase superfamily member 1 (enosf1) (see paper)
60% identity, 96% coverage: 15:443/448 of query aligns to 6:437/441 of 4a35A
- active site: K221 (= K229), K223 (= K231), D251 (= D259), N253 (= N261), E277 (= E285), E306 (= E312), D329 (= D335), H356 (= H362), S380 (= S386), E387 (= E393)
- binding magnesium ion: Y188 (= Y196), D251 (= D259), E277 (= E285), E306 (= E312), Y374 (= Y380)
Q7L5Y1 Mitochondrial enolase superfamily member 1; Antisense RNA to thymidylate synthase; rTS; L-fuconate dehydratase; EC 4.2.1.68 from Homo sapiens (Human) (see 5 papers)
60% identity, 96% coverage: 15:443/448 of query aligns to 5:436/443 of Q7L5Y1
- M145 (≠ Q154) to T: in dbSNP:rs2612086
- S148 (= S157) modified: Phosphoserine
- D250 (= D259) binding
- E276 (= E285) binding
- E305 (= E312) binding
Sites not aligning to the query:
- 1:27 mutation Missing: Impairs protein solubility. Abolishes catalytic activity.
Q8P3K2 L-fuconate dehydratase; FucD; EC 4.2.1.68 from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
58% identity, 96% coverage: 16:446/448 of query aligns to 4:435/441 of Q8P3K2
- GSD 22:24 (= GSD 34:36) binding
- Y32 (= Y44) binding
- K218 (= K229) binding
- K220 (= K231) mutation to A: Inactive.
- D248 (= D259) binding
- N250 (= N261) binding
- E274 (= E285) binding ; binding
- E301 (= E312) binding ; binding
- HAG 351:353 (= HAG 362:364) binding
- E382 (= E393) binding
2hxtA Crystal structure of l-fuconate dehydratase from xanthomonas campestris liganded with mg++ and d-erythronohydroxamate (see paper)
58% identity, 96% coverage: 16:446/448 of query aligns to 3:434/434 of 2hxtA
- active site: T54 (= T66), T189 (= T201), K217 (= K229), K219 (= K231), D247 (= D259), N249 (= N261), E273 (= E285), G299 (= G311), E300 (= E312), D323 (= D335), P349 (= P361), H350 (= H362), A351 (= A363), D367 (= D379), K374 (≠ S386), E381 (= E393)
- binding (2r,3r)-n,2,3,4-tetrahydroxybutanamide: G21 (= G34), D23 (= D36), Y31 (= Y44), K217 (= K229), K219 (= K231), E300 (= E312), H350 (= H362), G352 (= G364), E381 (= E393)
- binding magnesium ion: D247 (= D259), E273 (= E285), E300 (= E312)
1yeyC Crystal structure of l-fuconate dehydratase from xanthomonas campestris pv. Campestris str. Atcc 33913
58% identity, 96% coverage: 16:446/448 of query aligns to 4:435/435 of 1yeyC
- active site: T55 (= T66), T190 (= T201), K218 (= K229), K220 (= K231), D248 (= D259), N250 (= N261), E274 (= E285), G300 (= G311), E301 (= E312), D324 (= D335), P350 (= P361), H351 (= H362), A352 (= A363), D368 (= D379), K375 (≠ S386), E382 (= E393)
- binding magnesium ion: D248 (= D259), E274 (= E285), E301 (= E312)
2hxuA Crystal structure of k220a mutant of l-fuconate dehydratase from xanthomonas campestris liganded with mg++ and l-fuconate (see paper)
57% identity, 96% coverage: 16:446/448 of query aligns to 3:434/434 of 2hxuA
- active site: T54 (= T66), T189 (= T201), K217 (= K229), A219 (≠ K231), D247 (= D259), N249 (= N261), E273 (= E285), G299 (= G311), E300 (= E312), D323 (= D335), P349 (= P361), H350 (= H362), A351 (= A363), D367 (= D379), K374 (≠ S386), E381 (= E393)
- binding 6-deoxy-L-galactonic acid: G21 (= G34), D23 (= D36), Y31 (= Y44), W193 (= W205), K217 (= K229), D247 (= D259), E300 (= E312), H350 (= H362), G352 (= G364), E381 (= E393)
- binding magnesium ion: D247 (= D259), E273 (= E285), E300 (= E312)
4h19A Crystal structure of an enolase (mandelate racemase subgroup, target efi-502087) from agrobacterium tumefaciens, with bound mg and d- ribonohydroxamate, ordered loop
25% identity, 85% coverage: 53:433/448 of query aligns to 38:367/372 of 4h19A
- active site: T51 (= T66), T143 (= T201), K172 (= K229), K174 (= K231), D203 (= D259), N205 (= N261), E229 (= E285), G254 (= G311), E255 (= E312), Q276 (= Q333), D278 (= D335), H305 (= H362), A306 (= A363), G307 (= G364), E327 (= E393)
- binding (2R,3R,4R)-N,2,3,4,5-pentakis(oxidanyl)pentanamide: H52 (vs. gap), K172 (= K229), K174 (= K231), D203 (= D259), N205 (= N261), E229 (= E285), E255 (= E312), H305 (= H362), E327 (= E393)
- binding calcium ion: D268 (≠ Q325), H298 (≠ F355)
- binding magnesium ion: D203 (= D259), E229 (= E285), E255 (= E312)
Sites not aligning to the query:
3bjsB Crystal structure of a member of enolase superfamily from polaromonas sp. Js666
25% identity, 81% coverage: 77:439/448 of query aligns to 55:372/376 of 3bjsB
- active site: L93 (≠ P115), G136 (≠ T201), K164 (= K229), R166 (≠ K231), D194 (= D259), N196 (= N261), E220 (= E285), G246 (= G311), E247 (= E312), N248 (≠ H313), Q268 (= Q333), D270 (= D335), H297 (= H362), S298 (≠ A363), S299 (≠ G364), E322 (= E388), C324 (≠ R390), K327 (≠ E393)
- binding magnesium ion: D194 (= D259), E220 (= E285), E247 (= E312)
Sites not aligning to the query:
Q8ZL58 L-talarate/galactarate dehydratase; TalrD/GalrD; StTGD; EC 4.2.1.156; EC 4.2.1.42 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
28% identity, 76% coverage: 21:362/448 of query aligns to 44:328/398 of Q8ZL58
- DAK 46:48 (≠ DIR 23:25) binding
- KR 82:83 (≠ IG 67:68) binding
- K195 (= K229) binding
- K197 (= K231) active site, Proton acceptor; mutation to A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- D226 (= D259) binding
- N228 (= N261) binding
- E252 (= E285) binding
- E278 (= E312) binding
- H328 (= H362) active site, Proton donor/acceptor; mutation H->N,A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
Sites not aligning to the query:
2pp1A Crystal structure of l-talarate/galactarate dehydratase from salmonella typhimurium lt2 liganded with mg and l-lyxarohydroxamate (see paper)
28% identity, 76% coverage: 21:362/448 of query aligns to 41:325/395 of 2pp1A
- active site: K45 (≠ R25), S78 (≠ T66), K192 (= K229), K194 (= K231), D223 (= D259), N225 (= N261), E249 (= E285), G274 (= G311), E275 (= E312), D298 (= D335), H325 (= H362)
- binding (2r,3s,4r)-2,3,4-trihydroxy-5-(hydroxyamino)-5-oxopentanoic acid: D43 (= D23), K45 (≠ R25), K79 (≠ I67), F168 (≠ W205), K194 (= K231), E275 (= E312), H325 (= H362)
- binding magnesium ion: D223 (= D259), E249 (= E285), E275 (= E312)
Sites not aligning to the query:
2pp3A Crystal structure of l-talarate/galactarate dehydratase mutant k197a liganded with mg and l-glucarate (see paper)
28% identity, 76% coverage: 21:362/448 of query aligns to 41:325/395 of 2pp3A
- active site: K45 (≠ R25), S78 (≠ T66), K192 (= K229), A194 (≠ K231), D223 (= D259), N225 (= N261), E249 (= E285), G274 (= G311), E275 (= E312), D298 (= D335), H325 (= H362)
- binding l-glucaric acid: D43 (= D23), K79 (≠ I67), K192 (= K229), D223 (= D259), N225 (= N261), E275 (= E312), H325 (= H362)
- binding magnesium ion: D223 (= D259), E249 (= E285), E275 (= E312)
Sites not aligning to the query:
4hpnA Crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops (see paper)
31% identity, 48% coverage: 219:433/448 of query aligns to 154:373/378 of 4hpnA
- active site: K164 (= K229), K166 (= K231), D194 (= D259), N196 (= N261), E220 (= E285), G245 (= G311), E246 (= E312), T247 (≠ H313), Q267 (= Q333), D269 (= D335), H296 (= H362), V297 (≠ A363), W298 (≠ G364), R320 (≠ S384), E329 (= E393), F330 (≠ Y394), H334 (= H399)
- binding calcium ion: D194 (= D259), D209 (≠ K274), E220 (= E285), G237 (≠ V303), E246 (= E312)
Sites not aligning to the query:
5olcC Crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans (see paper)
30% identity, 48% coverage: 221:433/448 of query aligns to 140:348/351 of 5olcC
- active site: K148 (= K229), K150 (= K231), D178 (= D259), N180 (= N261), E204 (= E285), G229 (= G311), E230 (= E312), D253 (= D335), H280 (= H362), E304 (≠ S384), E309 (≠ G389)
- binding magnesium ion: D178 (= D259), E204 (= E285), E230 (= E312)
3stpA Crystal structure of a putative galactonate dehydratase
26% identity, 82% coverage: 66:434/448 of query aligns to 58:387/390 of 3stpA
- active site: L66 (≠ C74), S69 (≠ A77), S151 (≠ D160), K177 (= K185), R179 (= R187), P189 (= P197), E214 (≠ D259), Y216 (≠ N261), E240 (= E285), G265 (= G311), E266 (= E312), H267 (= H313), Q287 (= Q333), D289 (= D335), I311 (= I357), H316 (= H362), E336 (≠ G385), F341 (≠ R390)
- binding magnesium ion: E214 (≠ D259), E240 (= E285), E266 (= E312)
3ck5A Crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium
27% identity, 68% coverage: 123:425/448 of query aligns to 101:347/357 of 3ck5A
- active site: G137 (≠ E172), K164 (= K229), K166 (= K231), D195 (= D259), N197 (= N261), I220 (= I284), E221 (= E285), I243 (≠ V308), G246 (= G311), E247 (= E312), E268 (≠ Q333), D270 (= D335), H297 (= H362), G298 (= G367), V299 (≠ L368), Y315 (≠ I383), E317 (= E388)
- binding magnesium ion: D195 (= D259), E221 (= E285), E247 (= E312)
Sites not aligning to the query:
5xd8B Crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase (see paper)
27% identity, 73% coverage: 109:434/448 of query aligns to 91:361/367 of 5xd8B
- active site: G140 (≠ S157), K167 (= K229), K169 (= K231), D198 (= D259), N200 (= N261), E224 (= E285), G249 (= G311), E250 (= E312), Q271 (= Q333), D273 (= D335), H300 (= H362), G301 (= G367), M302 (≠ L368), W317 (≠ S386), E319 (= E388), P324 (≠ E393)
- binding magnesium ion: D198 (= D259), E224 (= E285), E250 (= E312)
Sites not aligning to the query:
Q9RKF7 3,6-anhydro-alpha-L-galactonate cycloisomerase; AHGA cycloisomerase; EC 5.5.1.25 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
27% identity, 68% coverage: 123:425/448 of query aligns to 101:350/361 of Q9RKF7
- D195 (= D259) binding
- E221 (= E285) binding
- E247 (= E312) binding
3sqsA Crystal structure of a putative mandelate racemase/muconate lactonizing protein from dinoroseobacter shibae dfl 12
27% identity, 59% coverage: 117:379/448 of query aligns to 104:325/386 of 3sqsA
- active site: S147 (≠ D160), K173 (≠ T200), R175 (≠ S202), G177 (= G204), G179 (≠ A220), K181 (≠ Q222), A185 (= A234), E210 (≠ D259), Y212 (≠ N261), E236 (= E285), G261 (= G311), E262 (= E312), H263 (= H313), Q283 (= Q333), D285 (= D335), I307 (= I357), H312 (= H362), G314 (= G364)
- binding magnesium ion: E210 (≠ D259), E236 (= E285), E262 (= E312)
Sites not aligning to the query:
Query Sequence
>Echvi_2941 FitnessBrowser__Cola:Echvi_2941
MRTLNLSTFLYMNIKITDYQVKDIRFPTSREKHGSDAMNPDPDYSAAYIILKTNQPDLEG
HGLTFTIGRGNEICCAALEAIAHHVIGKDLAALTADMGAFWRTVNSDSQIRWLGPEKGVV
HLATGALVNAVWDLYAKVEQKPLWKLLGEMTPEQLLSCIDFSYITDVLTKEEALDILKES
EKGKKERIRYLEENGYPGYTTSAGWLGYTDEKIRRLCREAKQEGWKHIKMKVGANLQDDI
RRAGIIREEIGEDMYLMMDANQRWEVAEAIENMKELAKFNPLWIEEPTSPDDILGHKAIA
DAVQPILVATGEHCQNRVIFKQLMQAGALQICQIDSCRVGGVNENLAIMLIAKKFDIPVC
PHAGGVGLCEYVQHLSMVDYISISGSMEGRVIEYVDHLHEHFIDPVVIKKGRYQVPKLPG
YSIQMKAASLEEYDFATGPIWNETAAKV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory