SitesBLAST
Comparing Echvi_2951 FitnessBrowser__Cola:Echvi_2951 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
4l2iB Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
36% identity, 81% coverage: 1:199/245 of query aligns to 1:201/263 of 4l2iB
- binding flavin-adenine dinucleotide: C6 (= C6), V7 (≠ I7), K8 (≠ T8), Y37 (= Y38), D38 (= D39), Y40 (= Y41), T60 (≠ N61), M61 (≠ V62), A92 (vs. gap), D93 (vs. gap), T94 (vs. gap), T97 (≠ D91), M101 (≠ V95), C116 (≠ M113), G117 (= G114), Q119 (≠ E116), A120 (≠ S117), G123 (≠ F120), T125 (≠ G122), A126 (≠ G123), V128 (= V125)
- binding nicotinamide-adenine-dinucleotide: M61 (≠ V62), G62 (= G63), P63 (≠ E64), S85 (≠ N86), D86 (vs. gap), G91 (vs. gap)
4kpuB Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
36% identity, 81% coverage: 1:199/245 of query aligns to 1:201/263 of 4kpuB
- binding flavin-adenine dinucleotide: C6 (= C6), V7 (≠ I7), K8 (≠ T8), Y37 (= Y38), D38 (= D39), Y40 (= Y41), M61 (≠ V62), A92 (vs. gap), D93 (vs. gap), T94 (vs. gap), T97 (≠ D91), C116 (≠ M113), G117 (= G114), Q119 (≠ E116), A120 (≠ S117), G123 (≠ F120), T125 (≠ G122), A126 (≠ G123), V128 (= V125)
P38117 Electron transfer flavoprotein subunit beta; Beta-ETF from Homo sapiens (Human) (see 10 papers)
31% identity, 91% coverage: 1:222/245 of query aligns to 4:235/255 of P38117
- A9 (≠ C6) binding
- NPFC 39:42 (≠ GPYD 36:39) binding
- C66 (≠ V62) binding
- 123:134 (vs. 114:125, 25% identical) binding
- D128 (= D119) to N: in GA2B; decreased protein stability; dbSNP:rs104894678
- T154 (≠ D145) to M: in dbSNP:rs1130426
- R164 (= R155) to Q: in GA2B; reduced electron transfer activity; dbSNP:rs104894677
- E165 (= E156) mutation E->A,Q: Drastically increases interprotein electron transfer rates.
- 183:205 (vs. 174:196, 22% identical) Recognition loop
- L195 (≠ M186) mutation to A: Severely impaired in complex formation with ACADM.
- K200 (≠ S191) modified: N6,N6,N6-trimethyllysine; by ETFBKMT; alternate; mutation to R: Does not abolish electron transfer activity. Decreases sensitivity to inhibition by lysine methyltransferase ETFBKMT.
- KAK 200:202 (≠ SAR 191:193) mutation to RAR: Does not abolish methylation by ETFBKMT.
- KAKK 200:203 (≠ SARS 191:194) mutation to RAKR: Does not abolish electron transfer activity. Abolishes sensitivity to inhibition by lysine methyltransferase ETFBKMT.
- K203 (≠ S194) modified: N6,N6,N6-trimethyllysine; by ETFBKMT; mutation to R: Does not abolish electron transfer activity. Decreases sensitivity to inhibition by lysine methyltransferase ETFBKMT.
2a1uB Crystal structure of the human etf e165betaa mutant (see paper)
30% identity, 100% coverage: 1:244/245 of query aligns to 1:252/252 of 2a1uB
- binding adenosine monophosphate: A6 (≠ C6), V7 (≠ I7), K8 (≠ T8), C39 (≠ D39), C63 (≠ V62), V101 (= V95), L119 (≠ M113), G120 (= G114), Q122 (≠ E116), A123 (≠ S117), D126 (≠ F120), C128 (≠ G122), N129 (≠ G123), Q130 (≠ M124), T131 (≠ V125)
- binding flavin-adenine dinucleotide: P37 (= P37), L182 (≠ E176)
1efpB Electron transfer flavoprotein (etf) from paracoccus denitrificans (see paper)
30% identity, 81% coverage: 1:198/245 of query aligns to 1:204/246 of 1efpB
- binding adenosine monophosphate: P6 (≠ C6), V7 (≠ I7), D39 (= D39), I63 (≠ V62), V101 (= V95), A119 (≠ M113), G120 (= G114), Q122 (≠ E116), A123 (≠ S117), N126 (≠ F120), M128 (≠ G122), N129 (≠ G123), T131 (≠ V125)
- binding flavin-adenine dinucleotide: Y13 (≠ T13), L182 (≠ E176)
6fahB Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
30% identity, 99% coverage: 1:243/245 of query aligns to 1:257/262 of 6fahB
- binding flavin-adenine dinucleotide: C6 (= C6), A7 (≠ I7), K8 (≠ T8), D38 (= D39), T61 (≠ N61), M62 (≠ V62), A93 (≠ D91), D94 (≠ S92), T95 (≠ L93), T98 (vs. gap), L102 (≠ Q98), G118 (= G114), Q120 (≠ E116), G124 (≠ F120), T126 (≠ G122), A127 (≠ G123), V129 (= V125), T223 (≠ K210)
Q2TBV3 Electron transfer flavoprotein subunit beta; Beta-ETF from Bos taurus (Bovine) (see paper)
30% identity, 91% coverage: 1:222/245 of query aligns to 4:235/255 of Q2TBV3
- K200 (≠ S191) modified: N6,N6,N6-trimethyllysine; by ETFBKMT; alternate
- K203 (≠ S194) modified: N6,N6,N6-trimethyllysine; by ETFBKMT
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
Q9DCW4 Electron transfer flavoprotein subunit beta; Beta-ETF from Mus musculus (Mouse) (see paper)
29% identity, 100% coverage: 1:244/245 of query aligns to 4:255/255 of Q9DCW4
- K200 (≠ S191) modified: N6,N6,N6-trimethyllysine; by ETFBKMT; alternate
- K203 (≠ S194) modified: N6,N6,N6-trimethyllysine; by ETFBKMT
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
5ol2B The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
33% identity, 69% coverage: 1:169/245 of query aligns to 1:171/260 of 5ol2B
- binding flavin-adenine dinucleotide: C6 (= C6), I7 (= I7), K8 (≠ T8), D38 (= D39), M61 (≠ V62), A92 (≠ S90), D93 (= D91), T94 (≠ S92), T97 (≠ V95), A115 (≠ M113), G116 (= G114), A119 (≠ S117), G122 (≠ F120), T124 (≠ G122), A125 (≠ G123), V127 (= V125)
5ow0B Crystal structure of an electron transfer flavoprotein from geobacter metallireducens (see paper)
28% identity, 99% coverage: 1:243/245 of query aligns to 1:246/251 of 5ow0B
- binding adenosine monophosphate: L6 (≠ C6), A7 (≠ I7), K8 (≠ T8), D39 (= D39), Y62 (≠ V62), I95 (≠ V95), A114 (≠ M113), G115 (= G114), Q117 (≠ E116), S118 (= S117), R123 (≠ G122), G124 (= G123), V125 (≠ M124), V126 (= V125), P127 (≠ H126)
- binding flavin-adenine dinucleotide: L37 (≠ P37), Y38 (= Y38)
7qh2B Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
28% identity, 80% coverage: 2:196/245 of query aligns to 3:201/265 of 7qh2B
- binding flavin-adenine dinucleotide: C7 (= C6), K9 (≠ T8), D39 (= D39), M62 (≠ V62), D94 (= D91), V95 (≠ S92), L102 (≠ I99), G118 (= G114), Q120 (≠ E116), T121 (≠ S117), T126 (≠ G122), A127 (≠ G123), V129 (= V125)
7koeA Electron bifurcating flavoprotein fix/etfabcx (see paper)
26% identity, 95% coverage: 3:234/245 of query aligns to 4:255/282 of 7koeA
- binding flavin-adenine dinucleotide: C7 (= C6), I8 (= I7), K9 (≠ T8), D39 (= D39), M62 (≠ V62), A93 (≠ D91), D94 (≠ S92), T95 (≠ L93), T98 (≠ A96), L102 (≠ A100), T121 (≠ M113), G122 (= G114), A125 (≠ S117), G128 (≠ F120), T130 (≠ G122), G131 (= G123), V133 (= V125)
P53570 Electron transfer flavoprotein subunit beta; Beta-ETF; Electron transfer flavoprotein small subunit; ETFSS from Methylophilus methylotrophus (Bacterium W3A1) (see paper)
28% identity, 99% coverage: 1:243/245 of query aligns to 1:262/264 of P53570
1o96A Structure of electron transferring flavoprotein for methylophilus methylotrophus. (see paper)
29% identity, 99% coverage: 1:243/245 of query aligns to 1:261/261 of 1o96A
- binding adenosine monophosphate: A6 (≠ C6), V7 (≠ I7), K8 (≠ T8), D38 (= D39), V63 (vs. gap), V99 (= V95), A117 (≠ M113), G118 (= G114), Q120 (≠ E116), S121 (= S117), Y126 (≠ G122), A127 (≠ G123), T129 (≠ V125)
- binding flavin-adenine dinucleotide: Q120 (≠ E116), Q182 (= Q175)
Query Sequence
>Echvi_2951 FitnessBrowser__Cola:Echvi_2951
MKILVCITHVPDTTSKIQFTDNNTKFDKTGVQFIIGPYDDYALARAVELRDQSSGSLTVL
NVGEAETEPTLRKALAIGADDAIRVNAFPSDSLFVANQIAHYAKEGGYDLILMGRESIDF
NGGMVHGMVAEMLGIPSVSPVMKLDLEGDTAKIAREIEGGKEHLEVKLPFVAGCQEPIAE
WKIPNMRGIMSARSKPLNVVEPVGEDAATKTVGYELPPAKGAVKLIDKDNVEELVKLLQN
EAKVL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory