Comparing Echvi_2954 FitnessBrowser__Cola:Echvi_2954 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
8tz7A Cryo-em structure of bovine concentrative nucleoside transporter 3 in complex with molnupiravir, condition 1, int1-int1-int1 conformation (see paper)
42% identity, 98% coverage: 9:426/428 of query aligns to 123:529/533 of 8tz7A
Sites not aligning to the query:
8tz6A Cryo-em structure of bovine concentrative nucleoside transporter 3 in complex with psi-6206 (see paper)
42% identity, 98% coverage: 9:426/428 of query aligns to 123:529/533 of 8tz6A
Sites not aligning to the query:
8tz5A Cryo-em structure of bovine concentrative nucleoside transporter 3 in complex with n-hydroxycytidine (see paper)
42% identity, 98% coverage: 9:426/428 of query aligns to 123:529/533 of 8tz5A
Sites not aligning to the query:
8tz4A Cryo-em structure of bovine concentrative nucleoside transporter 3 in complex with gs-441524, subset reconstruction (see paper)
42% identity, 98% coverage: 9:426/428 of query aligns to 123:529/533 of 8tz4A
8tz1A Cryo-em structure of bovine concentrative nucleoside transporter 3 in complex with ribavirin (see paper)
42% identity, 98% coverage: 9:426/428 of query aligns to 123:529/533 of 8tz1A
Sites not aligning to the query:
Q62674 Sodium/nucleoside cotransporter 1; Concentrative nucleoside transporter 1; CNT 1; Na(+)/nucleoside cotransporter 1; Sodium-coupled nucleoside transporter 1; Solute carrier family 28 member 1 from Rattus norvegicus (Rat) (see paper)
40% identity, 98% coverage: 9:427/428 of query aligns to 184:591/648 of Q62674
Sites not aligning to the query:
4pd7A Structure of vccnt bound to zebularine (see paper)
41% identity, 98% coverage: 7:424/428 of query aligns to 6:401/404 of 4pd7A
3tijA Crystal structure of a concentrative nucleoside transporter from vibrio cholerae (see paper)
41% identity, 98% coverage: 7:424/428 of query aligns to 6:401/404 of 3tijA
4pd5A Crystal structure of vccnt-7c8c bound to gemcitabine (see paper)
41% identity, 97% coverage: 9:424/428 of query aligns to 7:400/403 of 4pd5A
4pdaA Structure of vccnt-7c8c bound to cytidine (see paper)
41% identity, 97% coverage: 9:424/428 of query aligns to 8:401/404 of 4pdaA
4pd9A Structure of vccnt-7c8c bound to adenosine (see paper)
41% identity, 97% coverage: 9:424/428 of query aligns to 8:401/404 of 4pd9A
4pd8A Structure of vccnt-7c8c bound to pyrrolo-cytidine (see paper)
41% identity, 97% coverage: 9:424/428 of query aligns to 8:401/404 of 4pd8A
4pb2A Structure of vccnt-7c8c bound to 5-fluorouridine (see paper)
41% identity, 97% coverage: 9:424/428 of query aligns to 8:401/404 of 4pb2A
4pb1A Structure of vccnt-7c8c bound to ribavirin (see paper)
41% identity, 97% coverage: 9:424/428 of query aligns to 8:401/404 of 4pb1A
O00337 Sodium/nucleoside cotransporter 1; Concentrative nucleoside transporter 1; CNT 1; hCNT1; Na(+)/nucleoside cotransporter 1; Sodium-coupled nucleoside transporter 1; Solute carrier family 28 member 1 from Homo sapiens (Human) (see 7 papers)
40% identity, 96% coverage: 16:427/428 of query aligns to 189:591/649 of O00337
Sites not aligning to the query:
Q9HAS3 Solute carrier family 28 member 3; Concentrative Na(+)-nucleoside cotransporter 3; CNT 3; hCNT3 from Homo sapiens (Human) (see 5 papers)
43% identity, 85% coverage: 66:428/428 of query aligns to 263:614/691 of Q9HAS3
Sites not aligning to the query:
5l26A Structure of cntnw in an inward-facing substrate-bound state (see paper)
39% identity, 99% coverage: 1:425/428 of query aligns to 3:411/419 of 5l26A
5l2aA Structure of cntnw n149s,f366a in an outward-facing state (see paper)
38% identity, 99% coverage: 1:425/428 of query aligns to 4:417/422 of 5l2aA
>Echvi_2954 FitnessBrowser__Cola:Echvi_2954
MDYLRGMIGIVALLGVAFLFSASRKSVDWKLVGIGVILQIVFGFLITKVAFVESVFASIS
GAFVKLLSFAQAGAIFLFGDLATDSFGTIFAFQVLPTIIFFSTVSAGLYYLGVLQKIVFG
IAWVMARTMKLSGAESLSAAGNIFLGQTEAPLLVRPFIPTMTRSELMCLMTGGMATIAGG
VLAAYVAFLGGDDPAEQSKFASYLLGASIMNAPAAIVMSKLIIPETNKEGLNDKLEVSSE
GMGVNLIDAMSIGAADGLKLALNVGGMLLAFIAVIAMLNYLLSGVLGDVTGLNQFVVDTT
NGRFDGFSLEYILGQVFRIFAWLMGVEWQDTLQVGSLLGQKTVINEFVAYSDLSSMKAEG
DLSPKSIIIATYALCGFSNFSSIAIQVGGIGSIAPGQQGNLSKLGMHALLAATLACMMTA
TIAGMLFS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory