Comparing Echvi_2964 FitnessBrowser__Cola:Echvi_2964 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
40% identity, 57% coverage: 69:180/195 of query aligns to 131:243/261 of 6wyeA
Sites not aligning to the query:
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
40% identity, 57% coverage: 69:180/195 of query aligns to 129:241/243 of 7ra4A
Sites not aligning to the query:
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
33% identity, 78% coverage: 31:182/195 of query aligns to 95:243/243 of 4n69A
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
27% identity, 92% coverage: 3:182/195 of query aligns to 70:244/250 of 4hzdA
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
31% identity, 67% coverage: 60:190/195 of query aligns to 124:255/272 of 3gvdI
Sites not aligning to the query:
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
33% identity, 78% coverage: 31:182/195 of query aligns to 88:233/233 of 4n6bA
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
30% identity, 67% coverage: 60:190/195 of query aligns to 121:252/262 of 1t3dA
Sites not aligning to the query:
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
30% identity, 67% coverage: 60:190/195 of query aligns to 117:248/258 of 8i04A
Sites not aligning to the query:
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
26% identity, 84% coverage: 27:190/195 of query aligns to 94:248/258 of 4h7oA
Sites not aligning to the query:
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
31% identity, 63% coverage: 60:182/195 of query aligns to 120:243/246 of 8i09A
Sites not aligning to the query:
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
31% identity, 63% coverage: 60:182/195 of query aligns to 121:244/244 of 8i06A
Sites not aligning to the query:
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
24% identity, 82% coverage: 33:191/195 of query aligns to 100:249/257 of 1ssqD
Sites not aligning to the query:
1sstA Serine acetyltransferase- complex with coa (see paper)
25% identity, 77% coverage: 33:182/195 of query aligns to 100:233/233 of 1sstA
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
52% identity, 27% coverage: 132:183/195 of query aligns to 133:184/188 of 3igjC
Sites not aligning to the query:
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
33% identity, 57% coverage: 72:183/195 of query aligns to 64:182/186 of 4isxA
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
33% identity, 42% coverage: 108:189/195 of query aligns to 97:188/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
33% identity, 42% coverage: 108:189/195 of query aligns to 97:188/201 of 1kruA
Sites not aligning to the query:
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 42% coverage: 108:189/195 of query aligns to 98:189/203 of P07464
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
33% identity, 42% coverage: 108:189/195 of query aligns to 97:188/200 of 1krrA
Sites not aligning to the query:
8vr6A Crystal structure of the pcryo_0619 n-acetryltransferase from psychrobacter cryohalolentis k5 in the presence of coa-disulfide
29% identity, 56% coverage: 74:182/195 of query aligns to 60:168/177 of 8vr6A
>Echvi_2964 FitnessBrowser__Cola:Echvi_2964
MELIKTKEDLNRVLKIEKAKLNIKRPFLMWISYSEGYRVYRFFKNLRYLEFYLNKKKNPW
DYLPLAWRYWNHRRMKLKFSFYIHPNTLGEGFHLVHSGFVRIAVFANIGKNCTVLPRVLI
GKKKPRIEDPRVLIGEDCYIGTGVTILGPIKIGNNVTIAAGSVVTHDVPDNCVIGGIPAK
IIKYKNSPDPVSSSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory