Comparing Echvi_2982 FitnessBrowser__Cola:Echvi_2982 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P18159 Phosphoglucomutase; PGM; Alpha-phosphoglucomutase; Glucose phosphomutase; EC 5.4.2.2 from Bacillus subtilis (strain 168) (see paper)
43% identity, 94% coverage: 11:549/575 of query aligns to 8:552/581 of P18159
O74478 Probable phosphoribomutase; PRM; Phosphoglucomutase 3 homolog; PGM 3 homolog; EC 5.4.2.7 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
33% identity, 94% coverage: 13:552/575 of query aligns to 12:564/587 of O74478
Q96G03 Phosphopentomutase; Glucose phosphomutase 2; Phosphodeoxyribomutase; Phosphoglucomutase-2; EC 5.4.2.7; EC 5.4.2.2 from Homo sapiens (Human) (see 2 papers)
31% identity, 99% coverage: 3:574/575 of query aligns to 12:599/612 of Q96G03
Sites not aligning to the query:
Q03262 Phosphoribomutase; PRM; Phosphoglucomutase 3; PGM 3; EC 5.4.2.7 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
30% identity, 93% coverage: 13:544/575 of query aligns to 20:585/622 of Q03262
1wqaA Crystal structure of pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with mg2+
26% identity, 86% coverage: 48:543/575 of query aligns to 5:430/455 of 1wqaA
2h5aX Complex of the enzyme pmm/pgm with xylose 1-phosphate (see paper)
30% identity, 44% coverage: 53:307/575 of query aligns to 11:239/455 of 2h5aX
Sites not aligning to the query:
2h4lX Complex of pmm/pgm with ribose 1-phosphate (see paper)
30% identity, 44% coverage: 53:307/575 of query aligns to 11:239/455 of 2h4lX
Sites not aligning to the query:
2fkfA Phosphomannomutase/phosphoglucomutase from pseudomonas aeruginosa with alpha-d-glucose 1,6-bisphosphate bound (see paper)
30% identity, 44% coverage: 53:307/575 of query aligns to 11:239/455 of 2fkfA
Sites not aligning to the query:
1pcmX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
30% identity, 44% coverage: 53:307/575 of query aligns to 11:239/455 of 1pcmX
Sites not aligning to the query:
1p5gX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
30% identity, 44% coverage: 53:307/575 of query aligns to 11:239/455 of 1p5gX
Sites not aligning to the query:
1p5dX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
30% identity, 44% coverage: 53:307/575 of query aligns to 11:239/455 of 1p5dX
Sites not aligning to the query:
P26276 Phosphomannomutase/phosphoglucomutase; PMM / PGM; EC 5.4.2.2; EC 5.4.2.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 10 papers)
30% identity, 44% coverage: 53:307/575 of query aligns to 19:247/463 of P26276
Sites not aligning to the query:
Q02E40 Phosphomannomutase/phosphoglucomutase; PMM / PGM; EC 5.4.2.2; EC 5.4.2.8 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see paper)
30% identity, 44% coverage: 53:307/575 of query aligns to 19:247/463 of Q02E40
4il8A Crystal structure of an h329a mutant of p. Aeruginosa pmm/pgm (see paper)
30% identity, 44% coverage: 53:307/575 of query aligns to 15:243/459 of 4il8A
Sites not aligning to the query:
1pcjX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
30% identity, 44% coverage: 53:307/575 of query aligns to 14:242/458 of 1pcjX
Sites not aligning to the query:
1k2yX Crystal structure of phosphomannomutase/phosphoglucomutase s108a mutant from p. Aeruginosa (see paper)
30% identity, 44% coverage: 53:307/575 of query aligns to 15:243/459 of 1k2yX
Sites not aligning to the query:
P31120 Phosphoglucosamine mutase; EC 5.4.2.10 from Escherichia coli (strain K12) (see 3 papers)
25% identity, 69% coverage: 48:442/575 of query aligns to 7:364/445 of P31120
Sites not aligning to the query:
7omlA Bacillus subtilis phosphoglucomutase glmm (metal bound) (see paper)
24% identity, 86% coverage: 48:541/575 of query aligns to 4:418/445 of 7omlA
7ojrA Bacillus subtilis phosphoglucomutase glmm (phosphate bound) (see paper)
24% identity, 86% coverage: 48:541/575 of query aligns to 4:418/445 of 7ojrA
7pjcB The structure of candida albicans phosphoglucomutase with isothiazolone modification on cys359
23% identity, 68% coverage: 43:433/575 of query aligns to 10:400/553 of 7pjcB
>Echvi_2982 FitnessBrowser__Cola:Echvi_2982
MTDTSIITKAQSWLNSNIDQESKTKIQQLLDASDSSELVDAFYKDLEFGTGGLRGVMGIG
SNRMNVYTVGMATQGLANYLLACFPGEDIKVAITHDSRINNTLFAETTANVLTANGIKVK
YFEEMRPTPMLSYAIRHYGCKSGVMITASHNPKEYNGYKAYWEDGGQIVAPHDKNIIMEV
QKIKSIDDVKWDKNDALIEYIGAEMDLTYLNDIKKFSLSPKAILNQRDMCIVFSPIHGAS
GKMVPAALKTFGFENIHVVKEQEAPDGTFPTVVYPNPEEAEALSLSLKLAKEVNAELVLA
CDPDGDRYAAAIPNEKGEYELLNGNQTGSILTYYLLNQWREHGLFTGDQFMVNTIVTTEL
IEEICHGFNIPCYRVLTGFKNIAAIIRELEGKKQFVGGGEESYGFLVGDAVRDKDGVSAC
AMLAEVVAYYKEKGMTLFDVLAEIYQSYGFYKESLISVTKKGKDGAEQIQQLMHGFRTNR
PEAINGTKVVKVVDVKESKVYNIADGTEEDLDLDKSNVIQFYLEDGSKISARPSGTEPKI
KYYISVNESLPNRDAYRKVEASLAQKIEGLKKFFE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory