SitesBLAST
Comparing Echvi_2983 FitnessBrowser__Cola:Echvi_2983 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1t47A Structure of fe2-hppd bound to ntbc (see paper)
56% identity, 98% coverage: 4:357/363 of query aligns to 1:360/362 of 1t47A
- binding fe (ii) ion: H172 (= H169), H255 (= H252), E334 (= E331)
- binding 2-{hydroxy[2-nitro-4-(trifluoromethyl)phenyl]methylene}cyclohexane-1,3-dione: H172 (= H169), S215 (= S212), P228 (= P225), H255 (= H252), F321 (= F318), E334 (= E331), F344 (= F341), G345 (= G342), N348 (= N345), F349 (= F346), L352 (= L349)
5ec3A Structural insight into the catalyitc mechanism of human 4- hydroxyphenylpyruvate dioxygenase
51% identity, 96% coverage: 14:363/363 of query aligns to 14:373/376 of 5ec3A
8im2A Crystal structure of human hppd complexed with ntbc (see paper)
51% identity, 96% coverage: 14:362/363 of query aligns to 16:374/374 of 8im2A
- binding cobalt (ii) ion: H177 (= H169), H260 (= H252), E343 (= E331)
- binding 2-{hydroxy[2-nitro-4-(trifluoromethyl)phenyl]methylene}cyclohexane-1,3-dione: P233 (= P225), N235 (= N227), H260 (= H252), F330 (= F318), F341 (= F329), F353 (= F341), N357 (= N345), F358 (= F346), L361 (= L349)
8im3A Crystal structure of human hppd complexed with compound a10 (see paper)
51% identity, 95% coverage: 14:359/363 of query aligns to 16:371/371 of 8im3A
- binding [1,3-diethyl-2,2-bis(oxidanylidene)-2$l^{6},1,3-benzothiadiazol-5-yl]-(1-methyl-5-oxidanyl-pyrazol-4-yl)methanone: H177 (= H169), P233 (= P225), Q245 (= Q237), F330 (= F318), F341 (= F329), E343 (= E331), F353 (= F341), G354 (= G342), N357 (= N345), F358 (= F346), L361 (= L349)
- binding cobalt (ii) ion: H177 (= H169), H260 (= H252), E343 (= E331)
P32755 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; F Alloantigen; F protein; EC 1.13.11.27 from Rattus norvegicus (Rat) (see 2 papers)
50% identity, 96% coverage: 14:363/363 of query aligns to 22:381/393 of P32755
- H183 (= H169) binding
- H266 (= H252) binding
- E349 (= E331) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylthreonine
Q02110 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; EC 1.13.11.27 from Sus scrofa (Pig) (see paper)
46% identity, 96% coverage: 14:363/363 of query aligns to 22:381/393 of Q02110
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylthreonine
1sqiA Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases (see paper)
47% identity, 92% coverage: 14:348/363 of query aligns to 15:343/343 of 1sqiA
- binding (1-tert-butyl-5-hydroxy-1h-pyrazol-4-yl)[6-(methylsulfonyl)-4'-methoxy-2-methyl-1,1'-biphenyl-3-yl]methanone: P221 (= P225), Q228 (= Q237), H243 (= H252), F313 (= F318), F324 (= F329), E326 (= E331), F336 (= F341), N340 (= N345), F341 (= F346)
- binding fe (iii) ion: H176 (= H169), H243 (= H252), E326 (= E331)
1sqiB Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases (see paper)
46% identity, 92% coverage: 14:348/363 of query aligns to 16:342/342 of 1sqiB
- binding (1-tert-butyl-5-hydroxy-1h-pyrazol-4-yl)[6-(methylsulfonyl)-4'-methoxy-2-methyl-1,1'-biphenyl-3-yl]methanone: P220 (= P225), N222 (= N227), Q227 (= Q237), H242 (= H252), L299 (= L305), F312 (= F318), F323 (= F329), E325 (= E331), F335 (= F341), N339 (= N345), F340 (= F346)
- binding fe (iii) ion: H177 (= H169), H242 (= H252), E325 (= E331)
3zgjB S221m v223f y359a mutant of 4-hydroxymandelate synthase from streptomyces coelicolor (see paper)
36% identity, 97% coverage: 6:358/363 of query aligns to 1:343/343 of 3zgjB
P93836 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; EC 1.13.11.27 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 94% coverage: 13:354/363 of query aligns to 49:432/445 of P93836
- H226 (= H169) binding
- H308 (= H252) binding
- E394 (= E331) binding
7x8hA Crystal structure of athppd-(+)-usnic acid complex (see paper)
36% identity, 94% coverage: 13:354/363 of query aligns to 15:378/386 of 7x8hA
- binding (9bR)-2,6-diethanoyl-8,9b-dimethyl-3,7,9-tris(oxidanyl)dibenzofuran-1-one: H186 (= H169), F213 (= F198), S216 (= S208), L218 (= L210), S220 (= S212), P233 (= P225), H261 (= H252), F334 (= F318), F365 (vs. gap), K367 (vs. gap), F370 (= F346)
- binding cobalt (ii) ion: H186 (= H169), H261 (= H252), E347 (= E331)
7x8iA Crystal structure of athppd-shikonin complex (see paper)
36% identity, 94% coverage: 13:354/363 of query aligns to 15:376/380 of 7x8iA
- binding cobalt (ii) ion: H186 (= H169), H259 (= H252), E345 (= E331)
- binding 2-[(1R)-4-methyl-1-oxidanyl-pent-3-enyl]-5,8-bis(oxidanyl)naphthalene-1,4-dione: L216 (= L210), Q244 (= Q237), H259 (= H252), F332 (= F318), F343 (= F329), F363 (vs. gap), F368 (= F346)
7x64A Crystal structure of athppd-y18027 complex (see paper)
36% identity, 94% coverage: 13:354/363 of query aligns to 15:376/380 of 7x64A
- binding 1,5-dimethyl-6-(2-oxidanyl-6-oxidanylidene-cyclohexen-1-yl)carbonyl-3-(phenylmethyl)quinazoline-2,4-dione: H186 (= H169), S218 (= S212), P231 (= P225), R241 (≠ K234), Q244 (= Q237), H259 (= H252), F332 (= F318), F363 (vs. gap), G364 (vs. gap), N367 (= N345), F368 (= F346)
- binding cobalt (ii) ion: H186 (= H169), H259 (= H252), E345 (= E331)
7x5sA Crystal structure of athppd-y14157 complex
36% identity, 94% coverage: 13:354/363 of query aligns to 15:376/380 of 7x5sA
- binding 2-methyl-4-(2-nitro-4-piperidin-1-yl-phenyl)carbonyl-5-phenyl-1H-pyrazol-3-one: H186 (= H169), P231 (= P225), H259 (= H252), F332 (= F318), F343 (= F329), F363 (vs. gap), K365 (vs. gap), N367 (= N345), F368 (= F346)
- binding cobalt (ii) ion: H186 (= H169), H259 (= H252), E345 (= E331)
7x5rA Crystal structure of athppd-lancotrione complex
36% identity, 94% coverage: 13:354/363 of query aligns to 15:377/386 of 7x5rA
- binding (1R,3R)-2-[(S)-[2-chloranyl-3-[2-(1,3-dioxolan-2-yl)ethoxy]-4-methylsulfonyl-phenyl]-oxidanyl-methyl]cyclohexane-1,3-diol: H186 (= H169), S219 (= S212), P232 (= P225), H260 (= H252), M287 (≠ L275), F333 (= F318), F344 (= F329), E346 (= E331), F364 (vs. gap), N368 (= N345), F369 (= F346), L372 (= L349)
- binding cobalt (ii) ion: H186 (= H169), H260 (= H252), E346 (= E331)
8i15A Crystal structure of athppd-yh20335 complex
36% identity, 94% coverage: 13:354/363 of query aligns to 15:377/381 of 8i15A
- binding cobalt (ii) ion: H186 (= H169), H260 (= H252), E346 (= E331)
- binding 1,4-dimethyl-5-(2-oxidanyl-6-oxidanylidene-cyclohexen-1-yl)carbonyl-3-(phenylmethyl)benzimidazol-2-one: H186 (= H169), L217 (= L210), S219 (= S212), Q245 (= Q237), I246 (= I238), Q259 (= Q251), H260 (= H252), F333 (= F318), F344 (= F329), E346 (= E331), F364 (vs. gap), G365 (vs. gap), F369 (= F346)
8i0gA Crystal structure of athppd-y19543 complex
36% identity, 94% coverage: 13:354/363 of query aligns to 15:377/381 of 8i0gA
- binding cobalt (ii) ion: H186 (= H169), H260 (= H252), E346 (= E331)
- binding 3-[(4-fluorophenyl)methyl]-5-methyl-6-[(2-methyl-3-oxidanylidene-1H-pyrazol-4-yl)carbonyl]-1,2,3-benzotriazin-4-one: H186 (= H169), P232 (= P225), Q245 (= Q237), H260 (= H252), F333 (= F318), E346 (= E331), F364 (vs. gap), G365 (vs. gap), F369 (= F346)
8hysA Crystal structure of athppd-y19802 complex
36% identity, 94% coverage: 13:354/363 of query aligns to 15:377/381 of 8hysA
- binding cobalt (ii) ion: H186 (= H169), H260 (= H252), E346 (= E331)
- binding 1-methyl-3-[2-methyl-6-methylsulfonyl-3-(2-oxidanyl-6-oxidanylidene-cyclohexen-1-yl)carbonyl-phenyl]-6-(trifluoromethyl)pyrimidine-2,4-dione: H186 (= H169), S219 (= S212), Q245 (= Q237), H260 (= H252), M287 (≠ L275), F333 (= F318), E346 (= E331), F364 (vs. gap), N368 (= N345), F369 (= F346), L372 (= L349)
8hypA Crystal structure of athppd-y18400 complex
36% identity, 94% coverage: 13:354/363 of query aligns to 15:377/381 of 8hypA
- binding cobalt (ii) ion: H186 (= H169), H260 (= H252), E346 (= E331)
- binding 3-[(4-fluorophenyl)methyl]-1,5-dimethyl-6-(2-oxidanyl-6-oxidanylidene-cyclohexen-1-yl)carbonyl-quinazoline-2,4-dione: H186 (= H169), S219 (= S212), H260 (= H252), F333 (= F318), F344 (= F329), F364 (vs. gap), K366 (vs. gap), N368 (= N345), F369 (= F346)
8hymA Crystal structure of athppd-y18030 complex
36% identity, 94% coverage: 13:354/363 of query aligns to 15:377/381 of 8hymA
- binding cobalt (ii) ion: H186 (= H169), H260 (= H252), E346 (= E331)
- binding 3-cyclopentyl-1,5-dimethyl-6-(2-oxidanyl-6-oxidanylidene-cyclohexen-1-yl)carbonyl-quinazoline-2,4-dione: H186 (= H169), S219 (= S212), P232 (= P225), H260 (= H252), M287 (≠ L275), F333 (= F318), E346 (= E331), F364 (vs. gap), G365 (vs. gap), N368 (= N345), F369 (= F346)
Query Sequence
>Echvi_2983 FitnessBrowser__Cola:Echvi_2983
MNNDFLPINGTDHVEFYVGNAKQSAMYYQAAFGFELVAYAGPETGIRDRASYVLKQGKIR
LVLTTALYQDHPIAKHVSKHGDGVKVLALGVDDADKAWQETTSRGAVSHESPRITQDSNG
SVKVASICTYGETIHTFVERKNYSGPFLPGYRVEKGINTTSVGLKHIDHCVGNVGWGEMN
EWVSFYKKVMGFNLLVTFDDKDISTEYSALMSKVVSNGNGYIKFPINEPAKGKKKSQIEE
YLDFYNGPGVQHIAIATDDIISTVSELRKRGVSFLMVPDNYYDNLKDRVGKIDEAIEALK
QLNILVDRDEEGYLLQIFTRPVQDRPTLFYEIIQRKGAQSFGKGNFKALFEAIEREQNLR
GNL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory