SitesBLAST
Comparing Echvi_2990 Echvi_2990 Acyl-CoA dehydrogenases to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2r0nA The effect of a glu370asp mutation in glutaryl-coa dehydrogenase on proton transfer to the dienolate intermediate (see paper)
51% identity, 96% coverage: 16:401/402 of query aligns to 2:388/390 of 2r0nA
- active site: L133 (= L148), T134 (= T149), A247 (= A260), E368 (= E381), R380 (≠ Q393)
- binding flavin-adenine dinucleotide: F131 (= F146), L133 (= L148), T134 (= T149), G139 (= G154), S140 (= S155), W166 (= W179), I167 (= I180), T168 (≠ S181), Y367 (= Y380), T370 (= T383), D372 (= D385)
- binding 3-thiaglutaryl-CoA: R92 (= R107), S93 (= S108), V97 (= V112), P142 (= P157), G238 (≠ S251), F241 (≠ L254), L244 (= L257), N245 (≠ D258), P318 (≠ S331), Y367 (= Y380), E368 (= E381), I377 (= I390)
1sirA The crystal structure and mechanism of human glutaryl-coa dehydrogenase (see paper)
51% identity, 96% coverage: 16:401/402 of query aligns to 2:388/390 of 1sirA
- active site: L133 (= L148), T134 (= T149), A247 (= A260), E368 (= E381), R380 (≠ Q393)
- binding flavin-adenine dinucleotide: F131 (= F146), L133 (= L148), T134 (= T149), G139 (= G154), S140 (= S155), W166 (= W179), I167 (= I180), T168 (≠ S181), Y367 (= Y380), T370 (= T383)
- binding s-4-nitrobutyryl-coa: S93 (= S108), S140 (= S155), F241 (≠ L254), G242 (≠ M255), L244 (= L257), N245 (≠ D258), R248 (= R261), P318 (≠ S331), Y367 (= Y380), E368 (= E381), R380 (≠ Q393)
2r0mA The effect of a glu370asp mutation in glutaryl-coa dehydrogenase on proton transfer to the dienolate intermediate (see paper)
51% identity, 96% coverage: 16:401/402 of query aligns to 2:388/390 of 2r0mA
- active site: L133 (= L148), T134 (= T149), A247 (= A260), D368 (≠ E381), R380 (≠ Q393)
- binding 4-nitrobutanoic acid: L101 (= L116), Y367 (= Y380), D368 (≠ E381)
- binding flavin-adenine dinucleotide: F131 (= F146), L133 (= L148), T134 (= T149), G139 (= G154), S140 (= S155), W166 (= W179), I167 (= I180), T168 (≠ S181), L210 (= L223), Y367 (= Y380), T370 (= T383)
3sf6A Crystal structure of glutaryl-coa dehydrogenase from mycobacterium smegmatis (see paper)
51% identity, 95% coverage: 20:402/402 of query aligns to 6:387/387 of 3sf6A
- active site: L134 (= L148), T135 (= T149), A245 (= A260), E366 (= E381), Q378 (= Q393)
- binding dihydroflavine-adenine dinucleotide: F132 (= F146), L134 (= L148), T135 (= T149), G140 (= G154), S141 (= S155), W165 (= W179), I166 (= I180), T167 (≠ S181), S361 (= S376), T364 (= T379), Y365 (= Y380), T368 (= T383), E370 (≠ D385), M371 (≠ I386)
2ebaA Crystal structure of the putative glutaryl-coa dehydrogenase from thermus thermophilus
54% identity, 95% coverage: 19:401/402 of query aligns to 2:380/380 of 2ebaA
- active site: L131 (= L148), T132 (= T149), A239 (= A260), E360 (= E381), R372 (≠ Q393)
- binding flavin-adenine dinucleotide: L131 (= L148), T132 (= T149), G136 (≠ H153), G137 (= G154), S138 (= S155), W161 (= W179), T163 (≠ S181), R265 (= R286), L272 (≠ I293), K275 (≠ F296), D333 (≠ Q354), I334 (= I355), G337 (= G358), T355 (≠ S376), T358 (= T379), Y359 (= Y380), T362 (= T383)
3gqtC Crystal structure of glutaryl-coa dehydrogenase from burkholderia pseudomallei with fragment (1,4-dimethyl-1,2,3,4- tetrahydroquinoxalin-6-yl)methylamine (see paper)
51% identity, 94% coverage: 24:401/402 of query aligns to 11:385/385 of 3gqtC
- active site: L135 (= L148), T136 (= T149), A250 (= A260), E365 (= E381), R377 (≠ Q393)
- binding 1-(1,4-dimethyl-1,2,3,4-tetrahydroquinoxalin-6-yl)methanamine: W166 (= W179), K210 (= K220), L213 (= L223), T218 (= T228), Y364 (= Y380)
3eonC 2.55a crystal structure of native glutaryl-coa dehydrogenase from burkholderia pseudomallei in complex with a small molecule (see paper)
51% identity, 94% coverage: 24:400/402 of query aligns to 11:382/382 of 3eonC
3swoA Crystal structure of a glutaryl-coa dehydrogenase from mycobacterium smegmatis in complex with fadh2 (see paper)
48% identity, 96% coverage: 19:402/402 of query aligns to 7:388/388 of 3swoA
- active site: L135 (= L148), T136 (= T149), A246 (= A260), E367 (= E381), K379 (≠ Q393)
- binding dihydroflavine-adenine dinucleotide: F133 (= F146), L135 (= L148), T136 (= T149), G141 (= G154), S142 (= S155), W166 (= W179), I167 (= I180), T168 (≠ S181), R272 (= R286), V274 (≠ Q288), F275 (= F289), L279 (≠ I293), Y282 (≠ F296), T340 (≠ Q354), L341 (≠ I355), G344 (= G358), I347 (= I361), T365 (= T379), Y366 (= Y380), T369 (= T383), E371 (≠ D385), M372 (≠ I386)
3gncA Crystal structure of glutaryl-coa dehydrogenase from burkholderia pseudomallei with fragment 6421 (see paper)
50% identity, 94% coverage: 24:400/402 of query aligns to 12:380/380 of 3gncA
3d6bC 2.2 a crystal structure of glutaryl-coa dehydrogenase from burkholderia pseudomallei (see paper)
51% identity, 94% coverage: 24:400/402 of query aligns to 11:377/377 of 3d6bC
2ix6A Short chain specific acyl-coa oxidase from arabidopsis thaliana, acx4 (see paper)
38% identity, 95% coverage: 20:402/402 of query aligns to 31:413/416 of 2ix6A
- active site: L158 (= L148), T159 (= T149), S271 (≠ A260), E392 (= E381), R404 (≠ Q393)
- binding flavin-adenine dinucleotide: T159 (= T149), G164 (= G154), S165 (= S155), W189 (= W179), N239 (≠ T228), R297 (= R286), F300 (= F289), L304 (≠ I293), F307 (= F296), N310 (≠ V299), E365 (≠ Q354), L366 (≠ I355), G369 (= G358), I372 (= I361), Y391 (= Y380), T394 (= T383), D396 (= D385)
Q96329 Acyl-coenzyme A oxidase 4, peroxisomal; AOX 4; G6p; Short-chain acyl-CoA oxidase; AtCX4; AtG6; SAOX; EC 1.3.3.6 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 95% coverage: 20:402/402 of query aligns to 47:429/436 of Q96329
2ix5A Short chain specific acyl-coa oxidase from arabidopsis thaliana, acx4 in complex with acetoacetyl-coa (see paper)
38% identity, 95% coverage: 20:402/402 of query aligns to 31:413/415 of 2ix5A
- active site: L158 (= L148), T159 (= T149), S271 (≠ A260), E392 (= E381), R404 (≠ Q393)
- binding acetoacetyl-coenzyme a: S165 (= S155), A167 (≠ P157), S168 (≠ G158), F261 (≠ L250), L268 (= L257), R272 (= R261), E392 (= E381), G393 (= G382), R404 (≠ Q393)
- binding flavin-adenine dinucleotide: L158 (= L148), T159 (= T149), G164 (= G154), S165 (= S155), W189 (= W179), N239 (≠ T228), R297 (= R286), F300 (= F289), L304 (≠ I293), F307 (= F296), L309 (= L298), N310 (≠ V299), E365 (≠ Q354), L366 (≠ I355), G368 (= G357), G369 (= G358), Y391 (= Y380), T394 (= T383), D396 (= D385), I397 (= I386)
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
37% identity, 91% coverage: 26:391/402 of query aligns to 2:372/378 of 5ol2F
- active site: L124 (= L148), T125 (= T149), G241 (≠ A260)
- binding calcium ion: E29 (= E53), E33 (≠ D57), R35 (≠ H59)
- binding coenzyme a persulfide: L238 (= L257), R242 (= R261), E362 (= E381), G363 (= G382)
- binding flavin-adenine dinucleotide: F122 (= F146), L124 (= L148), T125 (= T149), P127 (= P151), T131 (≠ S155), F155 (≠ W179), I156 (= I180), T157 (≠ S181), E198 (≠ H218), R267 (= R286), F270 (= F289), L274 (≠ I293), F277 (= F296), Q335 (= Q354), L336 (≠ I355), G338 (= G357), G339 (= G358), Y361 (= Y380), T364 (= T383), E366 (≠ D385)
Sites not aligning to the query:
1jqiA Crystal structure of rat short chain acyl-coa dehydrogenase complexed with acetoacetyl-coa (see paper)
36% identity, 90% coverage: 32:392/402 of query aligns to 11:376/384 of 1jqiA
- binding acetoacetyl-coenzyme a: L95 (= L116), F125 (= F146), S134 (= S155), F234 (≠ L250), M238 (≠ L254), Q239 (≠ M255), L241 (= L257), D242 (= D258), R245 (= R261), Y364 (= Y380), E365 (= E381), G366 (= G382)
- binding flavin-adenine dinucleotide: F125 (= F146), L127 (= L148), S128 (≠ T149), G133 (= G154), S134 (= S155), W158 (= W179), T160 (≠ S181), R270 (= R286), F273 (= F289), L280 (≠ F296), Q338 (= Q354), I339 (= I355), G342 (= G358), I360 (≠ S376), T367 (= T383), E369 (≠ D385), I370 (= I386)
Sites not aligning to the query:
P15651 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Rattus norvegicus (Rat) (see 2 papers)
36% identity, 90% coverage: 32:392/402 of query aligns to 38:403/412 of P15651
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
38% identity, 91% coverage: 24:390/402 of query aligns to 1:372/380 of 4l1fA
- active site: L125 (= L148), T126 (= T149), G242 (≠ A260), E363 (= E381)
- binding coenzyme a persulfide: T132 (≠ S155), H179 (= H201), F232 (≠ L250), M236 (≠ L254), E237 (≠ M255), L239 (= L257), D240 (= D258), R243 (= R261), Y362 (= Y380), E363 (= E381), G364 (= G382)
- binding flavin-adenine dinucleotide: F123 (= F146), L125 (= L148), T126 (= T149), G131 (= G154), T132 (≠ S155), F156 (≠ W179), I157 (= I180), T158 (≠ S181), R268 (= R286), Q270 (= Q288), F271 (= F289), I275 (= I293), F278 (= F296), L281 (≠ V299), Q336 (= Q354), I337 (= I355), G340 (= G358), I358 (≠ S376), Y362 (= Y380), T365 (= T383), Q367 (≠ D385)
- binding 1,3-propandiol: L5 (≠ F28), Q10 (≠ L33)
Sites not aligning to the query:
4n5fA Crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315
35% identity, 93% coverage: 24:395/402 of query aligns to 2:378/378 of 4n5fA
- active site: L126 (= L148), T127 (= T149), G243 (≠ A260), E364 (= E381), R376 (≠ Q393)
- binding dihydroflavine-adenine dinucleotide: L126 (= L148), T127 (= T149), G132 (= G154), S133 (= S155), F157 (≠ W179), T159 (≠ S181), T210 (= T228), Y363 (= Y380), T366 (= T383), E368 (≠ D385), M372 (≠ L389)
5lnxD Crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.
40% identity, 91% coverage: 31:397/402 of query aligns to 5:374/374 of 5lnxD
- active site: L122 (= L148), T123 (= T149), G239 (≠ A260), E358 (= E381), K370 (≠ Q393)
- binding flavin-adenine dinucleotide: L122 (= L148), T123 (= T149), G128 (= G154), S129 (= S155), F153 (≠ W179), T155 (≠ S181), R265 (= R286), Q267 (= Q288), F268 (= F289), I272 (= I293), N275 (≠ F296), I278 (≠ V299), Q331 (= Q354), I332 (= I355), G335 (= G358), Y357 (= Y380), T360 (= T383), E362 (≠ D385)
7y0aC Crystal structure of human short-chain acyl-coa dehydrogenase
37% identity, 90% coverage: 32:392/402 of query aligns to 14:379/387 of 7y0aC
- binding flavin-adenine dinucleotide: F128 (= F146), L130 (= L148), S131 (≠ T149), G136 (= G154), S137 (= S155), W161 (= W179), T163 (≠ S181), T214 (= T228), R273 (= R286), F276 (= F289), L280 (≠ I293), L283 (≠ F296), V285 (≠ L298), Q341 (= Q354), I342 (= I355), G345 (= G358), I363 (≠ S376), Y367 (= Y380), T370 (= T383), E372 (≠ D385), L376 (= L389)
Query Sequence
>Echvi_2990 Echvi_2990 Acyl-CoA dehydrogenases
MSSIQDHSASAKQDLFEGVDFYGLDDLFTAEHLLIRQSLRDFVKKEVSPYIEEWAQDAHF
PSEIVPKFGEIGAFGPQIPAKYGGGGLDYISYGLIMQEIERGDSGMRSTVSVQGSLVMYP
IHAFGSEEQREKFLPKLASGEWLGCFGLTEPDHGSNPGGLTTSFKDNGDHYLLNGAKMWI
SNAPEADIAVVWAKDENGRIHGLIVERGMEGFTTPTTHHKWSLRASCTGELVFDNVKVPK
ENLLPGKSGLSAPLMCLDAARYGIAWGAIGAAMDCYESAKRYAMERIQFDKPIAAFQLVQ
KKLAEMLTEITKAQLLAWRLGTLKDQGKATSAQISMAKRNNVAMALEIAREARQIHGGMG
ITGDYPIMRHMMNLESVITYEGTHDIHLLILGQEITGIPAFK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory