Comparing Echvi_3071 FitnessBrowser__Cola:Echvi_3071 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
7rk5B Mannitol-2-dehydrogenase bound to nadh from aspergillus fumigatus
27% identity, 82% coverage: 15:402/471 of query aligns to 30:425/501 of 7rk5B
4im7A Crystal structure of fructuronate reductase (ydfi) from e. Coli cft073 (efi target efi-506389) complexed with nadh and d-mannonate
29% identity, 58% coverage: 139:412/471 of query aligns to 152:414/483 of 4im7A
Sites not aligning to the query:
1m2wA Pseudomonas fluorescens mannitol 2-dehydrogenase ternary complex with NAD and d-mannitol (see paper)
26% identity, 62% coverage: 85:375/471 of query aligns to 95:390/492 of 1m2wA
Sites not aligning to the query:
1lj8A Crystal structure of mannitol dehydrogenase in complex with NAD (see paper)
26% identity, 62% coverage: 85:375/471 of query aligns to 95:390/492 of 1lj8A
Sites not aligning to the query:
P09424 Mannitol-1-phosphate 5-dehydrogenase; EC 1.1.1.17 from Escherichia coli (strain K12) (see paper)
23% identity, 81% coverage: 17:399/471 of query aligns to 1:334/382 of P09424
Q4X1A4 Mannitol-1-phosphate 5-dehydrogenase; M1PDH; MPD; MPDH; EC 1.1.1.17 from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata) (see paper)
22% identity, 36% coverage: 198:367/471 of query aligns to 145:302/388 of Q4X1A4
>Echvi_3071 FitnessBrowser__Cola:Echvi_3071
MKTLNRQTVDGITERPVKVLQFGEGNFLRGFVDWIIDTMNEKTDFNGDVQLVQPIQHGMG
KMINDQEGLYHVQLSGIQKGEAKEETRLITCVRGVVNPYESYEAYLKLAENLDLRFVVSN
TTEAGISYNPEDDDREKLPSSFPGKLTALLYKRFDTFNGDKAKGLHIIPCELIDKNGAKL
KEIILQYAALWQLPNGFIQWINEANTFSNTLVDRIVPGFPKETIKEIQENIGYEDNLVVK
AEPFHLWVIEGLDAVKAEFPAEEAGLDVKFVKDQSPYRTRKVRILNGAHTSLVPVAYLHG
LRTVRESVEDPVIGPFLNETIQGEIIPTLDLPKEELEQFANDVMDRFKNPFVKHLLSSIA
LNSISKFKVRVLPSLLEYVDRKGKLPSNLVRSLAALIVFYKGSYNGEATPVQDDEEIVNY
FKTIWESDDLDEAAGEVLKNVNFWDTDLTKVEGLQAAVSEQLSQLVDKEKV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory