SitesBLAST
Comparing Echvi_3159 FitnessBrowser__Cola:Echvi_3159 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
35% identity, 91% coverage: 24:431/449 of query aligns to 11:414/427 of 5e9sA
- binding aspartic acid: R274 (≠ T298), S275 (= S299), S276 (= S300), T313 (= T337), G353 (≠ A377), V354 (≠ I378), A357 (≠ G381), G358 (= G382), D394 (≠ G411), R397 (= R414), T398 (= T415)
- binding decyl-beta-d-maltopyranoside: L194 (≠ T218), G198 (≠ W222), Y202 (≠ L226)
- binding sodium ion: Y87 (≠ F107), T90 (= T110), S91 (≠ T111), S276 (= S300), G305 (= G329), A306 (= A330), T307 (= T331), N309 (= N333), N309 (= N333), M310 (= M334), D311 (= D335), S348 (= S372), I349 (= I373), G350 (= G374), T351 (= T375), N401 (= N418), V402 (= V419), D405 (= D422)
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
35% identity, 91% coverage: 24:431/449 of query aligns to 9:412/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
35% identity, 91% coverage: 24:431/449 of query aligns to 8:411/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ T218), G195 (≠ W222), R282 (≠ Q309)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ T298), S272 (= S299), S273 (= S300), M307 (= M334), T310 (= T337), G353 (= G380), A354 (≠ G381), R394 (= R414), T395 (= T415)
Sites not aligning to the query:
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
35% identity, 91% coverage: 24:431/449 of query aligns to 11:414/426 of 6xwnB
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
35% identity, 91% coverage: 24:431/449 of query aligns to 4:403/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ T298), S265 (= S300), M299 (= M334), T302 (= T337), T340 (= T375), G342 (≠ A377), V343 (≠ I378), G347 (= G382), D383 (≠ G411), R386 (= R414), T387 (= T415), N390 (= N418)
- binding decyl-beta-d-maltopyranoside: H23 (≠ Q45), V212 (≠ L247), A216 (≠ T251)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
33% identity, 92% coverage: 18:431/449 of query aligns to 6:414/425 of O59010
- S65 (= S83) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ T298) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ TSS 298:300) binding
- M311 (= M334) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (= T337) binding
- V355 (≠ I378) binding
- D394 (≠ G411) binding
- M395 (= M412) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R414) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N418) binding
- D405 (= D422) mutation to N: Strongly decreased affinity for aspartate.
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
33% identity, 92% coverage: 18:431/449 of query aligns to 3:411/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: Y4 (≠ L19), G66 (= G87), V83 (≠ L104), I157 (= I189), Y164 (≠ S196), K193 (≠ T218), T305 (= T331), I306 (≠ V332), I347 (= I373)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ V28), M199 (= M224), S275 (= S300), T311 (= T337), G356 (= G382), L384 (≠ I404), D391 (≠ G411), R394 (= R414)
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
33% identity, 92% coverage: 21:431/449 of query aligns to 1:406/408 of 6bauA
- binding cysteine: S270 (= S300), M303 (= M334), T306 (= T337), A345 (≠ P376), G346 (≠ A377), V347 (≠ I378), G351 (= G382), D386 (≠ G411), C389 (≠ R414), T390 (= T415), N393 (= N418)
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
33% identity, 92% coverage: 18:431/449 of query aligns to 6:414/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: Y7 (≠ L19), F46 (≠ P64), F46 (≠ P64), P75 (≠ K93), L91 (≠ G109), F95 (≠ V113), L130 (= L152), I133 (≠ T158), I159 (= I188), Y167 (≠ S196), K196 (≠ T218), G200 (≠ W222), I207 (= I229), F210 (= F232), L250 (= L271), I262 (≠ L284), M269 (≠ Q291), T334 (≠ S357), V335 (≠ L358), G336 (≠ L359), T340 (≠ V363), L343 (≠ V366), M399 (≠ A416)
- binding aspartic acid: S277 (= S299), S278 (= S300), T314 (= T337), G354 (≠ A377), A358 (≠ G381), G359 (= G382), D394 (≠ G411), R397 (= R414), T398 (= T415)
- binding sodium ion: Y89 (≠ F107), T92 (= T110), S93 (≠ T111), G306 (= G329), T308 (= T331), N310 (= N333), N310 (= N333), M311 (= M334), D312 (= D335), S349 (= S372), I350 (= I373), T352 (= T375), N401 (= N418), V402 (= V419), D405 (= D422)
Sites not aligning to the query:
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
33% identity, 92% coverage: 21:431/449 of query aligns to 1:406/409 of 6bavA
2nwwA Crystal structure of gltph in complex with tboa (see paper)
33% identity, 90% coverage: 27:431/449 of query aligns to 6:405/407 of 2nwwA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
33% identity, 81% coverage: 59:422/449 of query aligns to 51:391/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ L96), G89 (≠ K97), G92 (= G100), A95 (≠ V103), V96 (≠ L104), Y99 (≠ F107), M163 (≠ I188), F167 (≠ V192), F293 (= F324), V297 (≠ I328)
- binding aspartic acid: S268 (= S299), S269 (= S300), T306 (= T337), G346 (≠ A377), I347 (= I378), A350 (≠ G381), G351 (= G382), D380 (≠ G411), R383 (= R414), T384 (= T415)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
32% identity, 92% coverage: 21:431/449 of query aligns to 1:394/396 of 6bmiA
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
30% identity, 86% coverage: 39:422/449 of query aligns to 41:449/503 of Q10901
- N177 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N187 (≠ S177) modified: carbohydrate, N-linked (GlcNAc...) asparagine
8cv2A Human excitatory amino acid transporter 3 (eaat3) in an outward facing sodium-bound state (see paper)
31% identity, 88% coverage: 26:422/449 of query aligns to 9:412/433 of 8cv2A
- binding sodium ion: Y85 (≠ F107), T88 (= T110), T89 (= T111), G319 (= G329), A320 (= A330), N323 (= N333), N323 (= N333), M324 (= M334), D325 (= D335), N408 (= N418), D412 (= D422)
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
30% identity, 86% coverage: 60:445/449 of query aligns to 74:489/532 of O35874
- N201 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
32% identity, 81% coverage: 59:422/449 of query aligns to 43:377/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I88), S80 (≠ L96), G81 (≠ K97), G84 (= G100), Y91 (≠ F107), M156 (≠ I188), F160 (≠ V192), F286 (= F324), V290 (≠ I328)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (= I80), I148 (≠ M180), S262 (= S300), S263 (≠ A301), A292 (= A330), T293 (= T331), M296 (= M334), T299 (= T337), G329 (= G374), A336 (≠ G381), G337 (= G382), D366 (≠ G411), R369 (= R414), N373 (= N418)
7nsgA Structure of human excitatory amino acid transporter 3 (eaat3) in complex with hip-b
30% identity, 88% coverage: 26:422/449 of query aligns to 13:409/430 of 7nsgA
- binding (+)-3-Hydroxy-4,5,6,6a-tetrahydro-3aH-pyrrolo[3,4-d]isoxazole-6-carboxylic acid: S287 (= S300), D398 (≠ G411), R401 (= R414), T402 (= T415), N405 (= N418)
- binding (-)-3-Hydroxy-4,5,6,6a-tetrahydro-3aH-pyrrolo[3,4-d]isoxazole-6-carboxylic acid: P366 (= P379), D398 (≠ G411), R401 (= R414), T402 (= T415)
- binding cholesterol hemisuccinate: I258 (= I272)
Sites not aligning to the query:
6s3qA Structure of human excitatory amino acid transporter 3 (eaat3) in complex with tfb-tboa
30% identity, 88% coverage: 26:422/449 of query aligns to 13:409/430 of 6s3qA
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: S286 (= S299), S287 (= S300), T324 (= T337), A358 (= A371), G361 (= G374), V365 (≠ I378), A368 (≠ G381), T372 (≠ I385), D398 (≠ G411), R401 (= R414), T402 (= T415), N405 (= N418)
- binding cholesterol hemisuccinate: K80 (= K98), R84 (≠ G102)
P43007 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Homo sapiens (Human) (see 4 papers)
30% identity, 83% coverage: 60:432/449 of query aligns to 74:477/532 of P43007
- N201 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- E256 (= E214) to K: in SPATCCM; does not affect localization at the cell surface; decreased uptake of L-serine and L-alanine; Vmax is decreased by at least 50% for both substrates; 3-fold increase of affinity for L-serine; 2-fold increase of affinity for L-alanine; dbSNP:rs201278558
- R457 (≠ M412) to W: in SPATCCM; does not affect localization at the cell surface; loss of uptake of L-serine and L-alanine; dbSNP:rs761533681
Query Sequence
>Echvi_3159 FitnessBrowser__Cola:Echvi_3159
MFDTEIKSLKSLNHYLLKLVESRLWLKVIIALLLGVGFGLLLSPQNGWISKETADIAGNW
LALPGVLFLKLVQMIMIPLIVASIITGIASNDKDSLKKLGGGVLLYFLGTTIVSVSIGTI
LSQIFRPGRFLHQQALKEHNEITAVSTDEPELSFGVETIPDAISNLLPENPLASMVSGEM
LSIVIFTIIIGVAVLSLENDLLRPVKLLLSAIQEVCMTVVKWSMLLVPIAVFGLMAQLTS
SVGLSSLSGLTYYVGVVLLGLLFLVIFYLGLIVLLGKANPMHFLKKIRDVQLLAFSTTSS
AAVMPLSLQTAEEKLKVDKTISNFIIPIGATVNMDGTALYQTITTLFIAQAYGLEMSLLN
IIVVIVTIVAASIGTPAIPGGGVVILASVLGSVGIPAEGIIIIIGVERLLGMFRTAVNVM
GDLTACMVFNRLYDIKILKFLKKKLYNYG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory