SitesBLAST
Comparing Echvi_3160 FitnessBrowser__Cola:Echvi_3160 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1mtoA Crystal structure of a phosphofructokinase mutant from bacillus stearothermophilus bound with fructose-6-phosphate (see paper)
44% identity, 97% coverage: 5:317/323 of query aligns to 1:313/319 of 1mtoA
- active site: G11 (= G15), R72 (= R76), C73 (≠ S77), D103 (= D107), G104 (= G108), G124 (= G129), T125 (= T130), D127 (= D132), D129 (= D134), R171 (= R176)
- binding 6-O-phosphono-beta-D-fructofuranose: D127 (= D132), R162 (= R167), M169 (= M174), R171 (= R176), E222 (= E225), R243 (= R248), H249 (= H254), R252 (= R257)
6pfkA Phosphofructokinase, inhibited t-state (see paper)
44% identity, 97% coverage: 5:317/323 of query aligns to 1:313/319 of 6pfkA
- active site: G11 (= G15), R72 (= R76), C73 (≠ S77), D103 (= D107), G104 (= G108), G124 (= G129), T125 (= T130), D127 (= D132), D129 (= D134), R171 (= R176)
- binding 2-phosphoglycolic acid: R21 (≠ Y25), R25 (≠ K29), G58 (≠ Q62), D59 (≠ K63), R154 (= R159), R211 (≠ D214), K213 (≠ E216)
P00512 ATP-dependent 6-phosphofructokinase; ATP-PFK; Phosphofructokinase; Phosphohexokinase; EC 2.7.1.11 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
44% identity, 97% coverage: 5:317/323 of query aligns to 1:313/319 of P00512
- RSVVR 21:25 (≠ YAITK 25:29) binding
- D59 (≠ K63) binding
- RC 72:73 (≠ RS 76:77) binding
- D103 (= D107) binding
- TID 125:127 (= TID 130:132) binding in other chain
- R154 (= R159) binding in other chain
- R162 (= R167) binding
- MGR 169:171 (= MGR 174:176) binding in other chain
- GAE 185:187 (≠ GAD 190:192) binding in other chain
- R211 (≠ D214) binding in other chain
- KKH 213:215 (≠ EDA 216:218) binding in other chain
- E222 (= E225) binding in other chain
- R243 (= R248) binding
- HVQR 249:252 (≠ HIQR 254:257) binding in other chain
4pfkA Phosphofructokinase. Structure and control (see paper)
44% identity, 97% coverage: 5:317/323 of query aligns to 1:313/319 of 4pfkA
- active site: G11 (= G15), R72 (= R76), C73 (≠ S77), D103 (= D107), G104 (= G108), G124 (= G129), T125 (= T130), D127 (= D132), D129 (= D134), R171 (= R176)
- binding adenosine-5'-diphosphate: S9 (= S13), Y41 (= Y45), R72 (= R76), C73 (≠ S77), F76 (= F80), K77 (≠ L81), G104 (= G108), G108 (= G112), R154 (= R159), G185 (= G190), R211 (≠ D214), G212 (≠ S215), K213 (≠ E216), H215 (≠ A218)
- binding 6-O-phosphono-beta-D-fructofuranose: D127 (= D132), M169 (= M174), E222 (= E225), H249 (= H254), R252 (= R257)
- binding magnesium ion: G185 (= G190), E187 (≠ D192)
3pfkA Phosphofructokinase. Structure and control (see paper)
44% identity, 97% coverage: 5:317/323 of query aligns to 1:313/319 of 3pfkA
- active site: G11 (= G15), R72 (= R76), C73 (≠ S77), D103 (= D107), G104 (= G108), G124 (= G129), T125 (= T130), D127 (= D132), D129 (= D134), R171 (= R176)
- binding phosphate ion: R154 (= R159), K213 (≠ E216), H249 (= H254), R252 (= R257)
4i4iA Crystal structure of bacillus stearothermophilus phosphofructokinase mutant t156a bound to pep (see paper)
44% identity, 97% coverage: 5:317/323 of query aligns to 1:313/319 of 4i4iA
- active site: G11 (= G15), R72 (= R76), C73 (≠ S77), D103 (= D107), G104 (= G108), G124 (= G129), T125 (= T130), D127 (= D132), D129 (= D134), R171 (= R176)
- binding phosphoenolpyruvate: R21 (≠ Y25), R25 (≠ K29), G58 (≠ Q62), R154 (= R159), R211 (≠ D214), K213 (≠ E216), H215 (≠ A218)
5xz9A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
45% identity, 97% coverage: 5:317/323 of query aligns to 1:316/321 of 5xz9A
- binding adenosine-5'-triphosphate: S9 (= S13), Y41 (= Y45), C73 (≠ S77), F76 (= F80), K77 (≠ L81), G102 (= G106), D103 (= D107), G104 (= G108), S105 (≠ T109), R107 (≠ K111), G108 (= G112)
5xzaA Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adp (see paper)
45% identity, 97% coverage: 5:317/323 of query aligns to 1:316/322 of 5xzaA
Q2FXM8 ATP-dependent 6-phosphofructokinase; ATP-PFK; Phosphofructokinase; Phosphohexokinase; EC 2.7.1.11 from Staphylococcus aureus (strain NCTC 8325 / PS 47) (see paper)
45% identity, 97% coverage: 5:317/323 of query aligns to 1:316/322 of Q2FXM8
- RC 72:73 (≠ RS 76:77) binding
- GDGS 102:105 (≠ GDGT 106:109) binding
- TID 127:129 (= TID 130:132) binding in other chain
- G150 (≠ E153) mutation to D: Exhibits higher affinity for fructose 6-phosphate and higher catalytic activity with a loss of dimer conversion; in association with A-151.
- L151 (≠ N154) mutation to A: Exhibits higher affinity for fructose 6-phosphate and higher catalytic activity with a loss of tetramer-dimer conversion; in association with D-150.
- R164 (= R167) mutation to A: Complete loss of fructose 6-phosphate binding.
- MGR 171:173 (= MGR 174:176) binding in other chain
- E224 (= E225) binding in other chain
- R245 (= R248) mutation to A: Complete loss of fructose 6-phosphate binding.
- HVQR 251:254 (≠ HIQR 254:257) binding in other chain
5xz6A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
45% identity, 97% coverage: 5:317/323 of query aligns to 1:312/318 of 5xz6A
5xz7A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
45% identity, 97% coverage: 5:317/323 of query aligns to 1:312/322 of 5xz7A
1pfkA Crystal structure of the complex of phosphofructokinase from escherichia coli with its reaction products (see paper)
40% identity, 90% coverage: 5:296/323 of query aligns to 2:292/320 of 1pfkA
- active site: G12 (= G15), R73 (= R76), F74 (≠ S77), D104 (= D107), G105 (= G108), G125 (= G129), T126 (= T130), D128 (= D132), D130 (= D134), R172 (= R176)
- binding adenosine-5'-diphosphate: G11 (= G14), R22 (≠ Y25), R26 (≠ K29), Y56 (≠ H59), S59 (≠ Q62), D60 (≠ K63), R73 (= R76), F74 (≠ S77), F77 (= F80), R78 (≠ L81), G103 (= G106), D104 (= D107), G105 (= G108), S106 (≠ T109), M108 (≠ K111), G109 (= G112), R155 (= R159), G213 (≠ S215), K214 (≠ E216), H216 (≠ A218)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: G12 (= G15), R73 (= R76), T126 (= T130), D128 (= D132), M170 (= M174), E223 (= E225), H250 (= H254), R253 (= R257)
- binding magnesium ion: G186 (= G190), E188 (≠ D192)
P0A796 ATP-dependent 6-phosphofructokinase isozyme 1; ATP-PFK 1; Phosphofructokinase 1; 6-phosphofructokinase isozyme I; Phosphohexokinase 1; Sedoheptulose-7-phosphate kinase; EC 2.7.1.11 from Escherichia coli (strain K12) (see 2 papers)
40% identity, 90% coverage: 5:296/323 of query aligns to 2:292/320 of P0A796
- G12 (= G15) binding
- RGVVR 22:26 (≠ YAITK 25:29) binding
- RYSVSD 55:60 (≠ SHELQK 58:63) binding
- RF 73:74 (≠ RS 76:77) binding
- GDGS 103:106 (≠ GDGT 106:109) binding
- D104 (= D107) binding
- TID 126:128 (= TID 130:132) binding in other chain
- D128 (= D132) active site, Proton acceptor; mutation to S: 18000-fold reduction of catalytic rate.
- R155 (= R159) binding in other chain
- R163 (= R167) binding
- R172 (= R176) mutation to S: 3.4-fold reduction in turnover numbers.
- GCE 186:188 (≠ GAD 190:192) binding in other chain
- KKH 214:216 (≠ EDA 216:218) binding in other chain
- E223 (= E225) binding in other chain
- R244 (= R248) binding
- HIQR 250:253 (= HIQR 254:257) binding in other chain
Q92448 ATP-dependent 6-phosphofructokinase subunit alpha; ATP-dependent 6-phosphofructokinase 1; ATP-PFK 1; Phosphofructokinase 1; Glucose-induced selective autophagy 1 protein; Phosphohexokinase 1; EC 2.7.1.11 from Komagataella phaffii (strain GS115 / ATCC 20864) (Yeast) (Pichia pastoris) (see paper)
40% identity, 93% coverage: 6:307/323 of query aligns to 211:549/989 of Q92448
- D361 (= D132) mutation to S: Abolishes catalytic activity, but not the ability to modulate glucose-induced microautophagy of peroxisomes.
P47859 ATP-dependent 6-phosphofructokinase, platelet type; ATP-PFK; PFK-P; 6-phosphofructokinase type C; Phosphofructo-1-kinase isozyme C; PFK-C; Phosphohexokinase; EC 2.7.1.11 from Oryctolagus cuniculus (Rabbit) (see paper)
38% identity, 96% coverage: 6:316/323 of query aligns to 25:373/791 of P47859
Sites not aligning to the query:
- 12 modified: Phosphoserine; by PKA
P08237 ATP-dependent 6-phosphofructokinase, muscle type; ATP-PFK; PFK-M; 6-phosphofructokinase type A; Phosphofructo-1-kinase isozyme A; PFK-A; Phosphohexokinase; EC 2.7.1.11 from Homo sapiens (Human) (see 6 papers)
38% identity, 97% coverage: 6:319/323 of query aligns to 16:363/780 of P08237
- R39 (≠ K29) to P: in GSD7; Italian; dbSNP:rs121918193
- G57 (= G47) to V: in GSD7; Italian
- R100 (≠ K88) to Q: in dbSNP:rs2228500
- S180 (= S146) to C: in GSD7; Italian
- G209 (= G175) to D: in GSD7; loss of activity shown by complementation assays in yeast; dbSNP:rs767265360
- D309 (= D265) to G: in GSD7; Spanish; complete loss of enzyme activity; dbSNP:rs1169383137
Sites not aligning to the query:
- 543 D → A: in GSD7; Italian; dbSNP:rs121918194
- 557 modified: N6-(2-hydroxyisobutyryl)lysine
- 591 D → A: in GSD7; Italian
- 686 W → C: in GSD7; Japanese; dbSNP:rs121918196
- 696 R → H: in dbSNP:rs41291971
P00511 ATP-dependent 6-phosphofructokinase, muscle type; ATP-PFK; PFK-M; 6-phosphofructokinase type A; Phosphofructo-1-kinase isozyme A; PFK-A; Phosphohexokinase; EC 2.7.1.11 from Oryctolagus cuniculus (Rabbit) (see 2 papers)
37% identity, 97% coverage: 6:319/323 of query aligns to 16:363/780 of P00511
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylthreonine
- 775 modified: Phosphoserine; by PKA
3o8lA Structure of phosphofructokinase from rabbit skeletal muscle (see paper)
37% identity, 97% coverage: 6:319/323 of query aligns to 8:355/748 of 3o8lA
- active site: G17 (= G15), R80 (= R76), D111 (= D107), S156 (≠ T130), D158 (= D132), D160 (= D134), R202 (= R176)
- binding adenosine-5'-diphosphate: D165 (= D139), M166 (≠ Y140), F300 (≠ L264)
- binding adenosine-5'-triphosphate: G16 (= G14), Y47 (= Y45), R80 (= R76), C81 (≠ S77), R85 (≠ L81), G110 (= G106), G112 (= G108), S113 (≠ T109), T115 (≠ K111), G116 (= G112), W219 (≠ A193), H234 (vs. gap), R238 (≠ L206)
Sites not aligning to the query:
P17858 ATP-dependent 6-phosphofructokinase, liver type; ATP-PFK; PFK-L; 6-phosphofructokinase type B; Phosphofructo-1-kinase isozyme B; PFK-B; Phosphohexokinase; EC 2.7.1.11 from Homo sapiens (Human) (see 3 papers)
37% identity, 97% coverage: 6:319/323 of query aligns to 16:363/780 of P17858
- G81 (= G69) natural variant: G -> A
- R151 (vs. gap) to W: in dbSNP:rs755851304
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 527 T→A: Does not affect GlcNAcylation.
- 529 modified: carbohydrate, O-linked (GlcNAc) serine; S→A: Prevents GlcNAcylation and enhance enzyme activity.
7lw1A Human phosphofructokinase-1 liver type bound to activator na-11 (see paper)
37% identity, 97% coverage: 6:319/323 of query aligns to 6:353/744 of 7lw1A
- binding adenosine-5'-diphosphate: R78 (= R76), C79 (≠ S77), T83 (≠ L81), G108 (= G106), G110 (= G108), S111 (≠ T109), G114 (= G112), I117 (vs. gap)
- binding 6-O-phosphono-beta-D-fructofuranose: I155 (= I131), D156 (= D132), R191 (= R167), M198 (= M174), R200 (= R176), E254 (= E225), R282 (= R248), H288 (= H254), R291 (= R257)
- binding N-{(11S)-2-[2-(5-hydroxypent-1-yn-1-yl)phenyl]-4H,10H-pyrazolo[5,1-c][1,4]benzoxazepin-7-yl}acetamide: M164 (≠ Y140), F298 (≠ L264), I301 (≠ M267), K305 (≠ R271), N331 (= N294)
Sites not aligning to the query:
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: 399, 460, 519, 555, 562, 618, 644, 650, 724
- binding N-{(11S)-2-[2-(5-hydroxypent-1-yn-1-yl)phenyl]-4H,10H-pyrazolo[5,1-c][1,4]benzoxazepin-7-yl}acetamide: 527, 532, 535, 568, 660, 730, 734
Query Sequence
>Echvi_3160 FitnessBrowser__Cola:Echvi_3160
MDSTIKHIGVFTSGGDSPGMNAALYAITKTAEVNGINVSGFRKGYEGLIDGDLVQLKSHE
LQKLTQKGGTILKTARSKRFLELEGRKKALQTLNVNKIDALIAIGGDGTFKGLLAFSEIC
DIPFIGIPGTIDNDISGTDYTLGFDSAVNTAIENIDKIRDTAESHNRVFIVEVMGRDSGY
IGIHSGLMVGADAILIPESGTDFINLLGKVKNYDSEDAFLIVVSEGDEIGADLVSSKIKE
VNPNVDLRITKLGHIQRGGNPSALDRMLGIRLGVEAVKSLLQSKKNVMIGILNNQLHLTP
FNEVVKQHQVNKELHELLELFGT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory